AT27312.complete Sequence
759 bp (759 high quality bases) assembled on 2002-05-18
GenBank Submission: AY118716
> AT27312.complete
ATCGGGCAGGCCTTGCTTAACCACTTTTTAAGTAAGCCTGATAAATAAGG
GGAACAATACTAGTTAGCTGCAACGATAATCATGTCGAATACCAGTCGTC
GCGATATTTGGGTGCCCAGTCCCGCCATTATACTGCATCAGATGCAATCC
AACGAGGATGTGTCCGATGAATCAACTCTGGAATACCATGAGGAATCCAA
CCAGGCGTGGCGCGAACAGTATATGGCCAAAAACGTGGCCAGAATGGGAG
TCGGTTTCGAGTTCGTGAACTCAACCTCTCGCTACATGAGCTCCTTGAGC
AGCACCCAGGATGACGATACAGAGAACCACGTGATTGGTAATTCATCTTC
CAGCACCACCTATCGAGTGGGGCCCACCATCCGAATCCCCCGTCTCGAAA
TTCAGTCTTACAGTTCCGGGTCGGATGACGAGAACCTGATCCAGCACCTG
GCGTAATCCAAATGCCTATTATTCACAAAATTCCCAGTGCTTGAGAGCCT
TATCCGATTTCTTCGTTTTCATCACCAGGATACTCGTGCCTGTCCTACCG
CTGCCGCATCTAAGCTCCAATGAATCCGGACTGGAGGCGCGATGCCCTTA
ATTGTGGTATTTTATAGTATAAAATTAAGTTGCATTTCATCTTGTTTTGT
TTGCTATCACGAATCGAAAGACCTTCGTCTAGGCTCTCTGAACCTGAACT
AACAATAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAA
AT27312.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 19:04:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13039-RA | 706 | CG13039-RA | 1..706 | 1..706 | 3500 | 99.7 | Plus |
CG13039.a | 515 | CG13039.a | 1..338 | 1..338 | 1690 | 100 | Plus |
CG13039.a | 515 | CG13039.a | 337..515 | 528..706 | 865 | 98.8 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:30:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3L | 24539361 | chr3L | 16315775..16316480 | 706..1 | 3530 | 100 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:00:13 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:30:48
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 16326056..16326762 | 707..1 | 3505 | 99.7 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:36:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28103327 | 3L | 16319156..16319862 | 707..1 | 3505 | 99.7 | Minus |
Blast to na_te.dros performed on 2019-03-15 15:30:49 has no hits.
AT27312.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:31:59 Download gff for
AT27312.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3L | 16315775..16316480 | 1..706 | 100 | | Minus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:25:10 Download gff for
AT27312.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13039-RA | 1..375 | 82..456 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:46:54 Download gff for
AT27312.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13039-RA | 1..375 | 82..456 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:31:11 Download gff for
AT27312.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13039-RA | 1..375 | 82..456 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:39:12 Download gff for
AT27312.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13039-RA | 1..375 | 82..456 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:08:36 Download gff for
AT27312.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13039-RA | 1..375 | 82..456 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:22:42 Download gff for
AT27312.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13039-RA | 1..706 | 1..706 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:46:54 Download gff for
AT27312.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13039-RA | 1..706 | 1..706 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:31:11 Download gff for
AT27312.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13039-RA | 1..706 | 1..706 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:39:12 Download gff for
AT27312.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13039-RA | 1..706 | 1..706 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:08:36 Download gff for
AT27312.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13039-RA | 1..706 | 1..706 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:31:59 Download gff for
AT27312.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 16326057..16326762 | 1..706 | 99 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:31:59 Download gff for
AT27312.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 16326057..16326762 | 1..706 | 99 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:31:59 Download gff for
AT27312.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 16326057..16326762 | 1..706 | 99 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:31:11 Download gff for
AT27312.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 16319157..16319862 | 1..706 | 99 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:11:35 Download gff for
AT27312.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 16319157..16319862 | 1..706 | 99 | | Minus |
AT27312.hyp Sequence
Translation from 81 to 455
> AT27312.hyp
MSNTSRRDIWVPSPAIILHQMQSNEDVSDESTLEYHEESNQAWREQYMAK
NVARMGVGFEFVNSTSRYMSSLSSTQDDDTENHVIGNSSSSTTYRVGPTI
RIPRLEIQSYSSGSDDENLIQHLA*
AT27312.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:18:42
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13039-PA | 124 | CG13039-PA | 1..124 | 1..124 | 638 | 100 | Plus |
AT27312.pep Sequence
Translation from 81 to 455
> AT27312.pep
MSNTSRRDIWVPSPAIILHQMQSNEDVSDESTLEYHEESNQAWREQYMAK
NVARMGVGFEFVNSTSRYMSSLSSTQDDDTENHVIGNSSSSTTYRVGPTI
RIPRLEIQSYSSGSDDENLIQHLA*
AT27312.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:00:38
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF10293-PA | 125 | GF10293-PA | 14..125 | 11..124 | 241 | 46.5 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:00:38
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG13465-PA | 125 | GG13465-PA | 1..125 | 1..124 | 471 | 76.4 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:24:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13039-PA | 124 | CG13039-PA | 1..124 | 1..124 | 638 | 100 | Plus |
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:00:39
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dmoj\GI12655-PA | 122 | GI12655-PA | 4..90 | 5..96 | 147 | 34.8 | Plus |
Dmoj\GI16880-PA | 122 | GI16880-PA | 4..90 | 5..96 | 147 | 34.8 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:00:41
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM24414-PA | 124 | GM24414-PA | 1..124 | 1..124 | 610 | 93.5 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:00:41
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD12484-PA | 124 | GD12484-PA | 1..124 | 1..124 | 613 | 94.4 | Plus |
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:00:42
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dvir\GJ12629-PA | 127 | GJ12629-PA | 4..98 | 1..96 | 142 | 36.4 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:00:43
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE22566-PA | 123 | GE22566-PA | 1..123 | 1..124 | 533 | 83.1 | Plus |
Dyak\GE22562-PA | 123 | GE22562-PA | 1..123 | 1..124 | 533 | 83.1 | Plus |