Clone AT27312 Report

Search the DGRC for AT27312

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:273
Well:12
Vector:pOTB7
Associated Gene/TranscriptCG13039-RA
Protein status:AT27312.pep: gold
Preliminary Size:375
Sequenced Size:759

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13039 2002-01-01 Sim4 clustering to Release 2
CG13039 2002-05-18 Blastp of sequenced clone
CG13039 2003-01-01 Sim4 clustering to Release 3
CG13039 2008-04-29 Release 5.5 accounting
CG13039 2008-08-15 Release 5.9 accounting
CG13039 2008-12-18 5.12 accounting

Clone Sequence Records

AT27312.complete Sequence

759 bp (759 high quality bases) assembled on 2002-05-18

GenBank Submission: AY118716

> AT27312.complete
ATCGGGCAGGCCTTGCTTAACCACTTTTTAAGTAAGCCTGATAAATAAGG
GGAACAATACTAGTTAGCTGCAACGATAATCATGTCGAATACCAGTCGTC
GCGATATTTGGGTGCCCAGTCCCGCCATTATACTGCATCAGATGCAATCC
AACGAGGATGTGTCCGATGAATCAACTCTGGAATACCATGAGGAATCCAA
CCAGGCGTGGCGCGAACAGTATATGGCCAAAAACGTGGCCAGAATGGGAG
TCGGTTTCGAGTTCGTGAACTCAACCTCTCGCTACATGAGCTCCTTGAGC
AGCACCCAGGATGACGATACAGAGAACCACGTGATTGGTAATTCATCTTC
CAGCACCACCTATCGAGTGGGGCCCACCATCCGAATCCCCCGTCTCGAAA
TTCAGTCTTACAGTTCCGGGTCGGATGACGAGAACCTGATCCAGCACCTG
GCGTAATCCAAATGCCTATTATTCACAAAATTCCCAGTGCTTGAGAGCCT
TATCCGATTTCTTCGTTTTCATCACCAGGATACTCGTGCCTGTCCTACCG
CTGCCGCATCTAAGCTCCAATGAATCCGGACTGGAGGCGCGATGCCCTTA
ATTGTGGTATTTTATAGTATAAAATTAAGTTGCATTTCATCTTGTTTTGT
TTGCTATCACGAATCGAAAGACCTTCGTCTAGGCTCTCTGAACCTGAACT
AACAATAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAA

AT27312.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:04:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG13039-RA 706 CG13039-RA 1..706 1..706 3500 99.7 Plus
CG13039.a 515 CG13039.a 1..338 1..338 1690 100 Plus
CG13039.a 515 CG13039.a 337..515 528..706 865 98.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:30:51
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 16315775..16316480 706..1 3530 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:00:13 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:30:48
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16326056..16326762 707..1 3505 99.7 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:36:12
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 16319156..16319862 707..1 3505 99.7 Minus
Blast to na_te.dros performed on 2019-03-15 15:30:49 has no hits.

AT27312.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:31:59 Download gff for AT27312.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 16315775..16316480 1..706 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:25:10 Download gff for AT27312.complete
Subject Subject Range Query Range Percent Splice Strand
CG13039-RA 1..375 82..456 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:46:54 Download gff for AT27312.complete
Subject Subject Range Query Range Percent Splice Strand
CG13039-RA 1..375 82..456 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:31:11 Download gff for AT27312.complete
Subject Subject Range Query Range Percent Splice Strand
CG13039-RA 1..375 82..456 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:39:12 Download gff for AT27312.complete
Subject Subject Range Query Range Percent Splice Strand
CG13039-RA 1..375 82..456 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:08:36 Download gff for AT27312.complete
Subject Subject Range Query Range Percent Splice Strand
CG13039-RA 1..375 82..456 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:22:42 Download gff for AT27312.complete
Subject Subject Range Query Range Percent Splice Strand
CG13039-RA 1..706 1..706 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:46:54 Download gff for AT27312.complete
Subject Subject Range Query Range Percent Splice Strand
CG13039-RA 1..706 1..706 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:31:11 Download gff for AT27312.complete
Subject Subject Range Query Range Percent Splice Strand
CG13039-RA 1..706 1..706 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:39:12 Download gff for AT27312.complete
Subject Subject Range Query Range Percent Splice Strand
CG13039-RA 1..706 1..706 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:08:36 Download gff for AT27312.complete
Subject Subject Range Query Range Percent Splice Strand
CG13039-RA 1..706 1..706 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:31:59 Download gff for AT27312.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16326057..16326762 1..706 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:31:59 Download gff for AT27312.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16326057..16326762 1..706 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:31:59 Download gff for AT27312.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16326057..16326762 1..706 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:31:11 Download gff for AT27312.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16319157..16319862 1..706 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:11:35 Download gff for AT27312.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16319157..16319862 1..706 99   Minus

AT27312.hyp Sequence

Translation from 81 to 455

> AT27312.hyp
MSNTSRRDIWVPSPAIILHQMQSNEDVSDESTLEYHEESNQAWREQYMAK
NVARMGVGFEFVNSTSRYMSSLSSTQDDDTENHVIGNSSSSTTYRVGPTI
RIPRLEIQSYSSGSDDENLIQHLA*

AT27312.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:18:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG13039-PA 124 CG13039-PA 1..124 1..124 638 100 Plus

AT27312.pep Sequence

Translation from 81 to 455

> AT27312.pep
MSNTSRRDIWVPSPAIILHQMQSNEDVSDESTLEYHEESNQAWREQYMAK
NVARMGVGFEFVNSTSRYMSSLSSTQDDDTENHVIGNSSSSTTYRVGPTI
RIPRLEIQSYSSGSDDENLIQHLA*

AT27312.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:00:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10293-PA 125 GF10293-PA 14..125 11..124 241 46.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:00:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13465-PA 125 GG13465-PA 1..125 1..124 471 76.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:24:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG13039-PA 124 CG13039-PA 1..124 1..124 638 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:00:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12655-PA 122 GI12655-PA 4..90 5..96 147 34.8 Plus
Dmoj\GI16880-PA 122 GI16880-PA 4..90 5..96 147 34.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:00:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24414-PA 124 GM24414-PA 1..124 1..124 610 93.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:00:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12484-PA 124 GD12484-PA 1..124 1..124 613 94.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:00:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12629-PA 127 GJ12629-PA 4..98 1..96 142 36.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:00:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22566-PA 123 GE22566-PA 1..123 1..124 533 83.1 Plus
Dyak\GE22562-PA 123 GE22562-PA 1..123 1..124 533 83.1 Plus