Clone AT27602 Report

Search the DGRC for AT27602

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:276
Well:2
Vector:pOTB7
Associated Gene/Transcriptsan-RA
Protein status:AT27602.pep: gold
Preliminary Size:824
Sequenced Size:845

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12352 2002-01-01 Sim4 clustering to Release 2
CG12352 2002-06-10 Blastp of sequenced clone
CG12352 2003-01-01 Sim4 clustering to Release 3
san 2008-04-29 Release 5.5 accounting
san 2008-08-15 Release 5.9 accounting
san 2008-12-18 5.12 accounting

Clone Sequence Records

AT27602.complete Sequence

845 bp (845 high quality bases) assembled on 2002-06-10

GenBank Submission: AY070826

> AT27602.complete
CGATAACGATAACTTGCGACCTGCAACCCGAACAATCAGGAACAGCTGAG
GCGCTTAAAACACATTTTCCTATTACAATTTTCGGCGCAAAGCGCGTTGC
TAAATCAACAGAAATCGTACAGACAACATGACTAGGAGCAGCATCGAACT
GGGCGACGTGACGCCCCACAACATCAAGCAGCTAAAGAAGCTCAACACCG
TGGTTTTCCCGGTCTCCTACAATGACAAGTTTTACGTGGACGTCCTGGAG
GCCGGCGAACTGGCCAAATTGGCCTACTACAACGACATTGTAGTGGGCGC
CGTCTGCTGTCGCATCGACAACACTGAGAACCAGCGGCGCCTGTATATCA
TGACCCTAGGATGCCTCTCCCCGTACCGGCGCCTGGGCATCGGCACAGTT
ATGTTCGAGCACATTATGAACTTCGCCGAGAAGGACGGAAACTTCGACAG
CATTTTTCTACATGTGCAAATCAACAACAACGGAGCCATCGAGTTCTATA
AGAAGTTTGGTTTCGAGATTGTTGACACCAAGGAGCAATACTATAAGCGC
ATCGAGCCGGCGGACGCTCATGTACTGCAAAAGACTCTGCGCCGCACTGC
ACCCAACTCAAACAGCACCGCCACCAGCACCACCGCGAACTCAAATTCAC
GTAGTAAAGCACGACAGTTCACATTTGTTTAAAGATGAATTTCAATATGT
ATAACAAACAGACATGTAGAGGCGGCCAAAACGATGTATTCAATTAGTCC
GATCATATCTATGTGTAATCAATAATAATTACCCCTGCGCGGGAATAAAT
AGCTCTATACGGCTTGAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

AT27602.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:20:50
Subject Length Description Subject Range Query Range Score Percent Strand
san-RA 1028 san-RA 27..842 1..816 4065 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:57:59
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 7248965..7249321 460..816 1785 100 Plus
chr2R 21145070 chr2R 7248407..7248732 134..459 1630 100 Plus
chr2R 21145070 chr2R 7248148..7248283 1..136 680 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:00:32 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:57:57
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 11361515..11361871 460..816 1785 100 Plus
2R 25286936 2R 11360957..11361282 134..459 1615 99.7 Plus
2R 25286936 2R 11360698..11360833 1..136 680 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:59:29
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 11362714..11363070 460..816 1785 100 Plus
2R 25260384 2R 11362156..11362481 134..459 1615 99.6 Plus
2R 25260384 2R 11361897..11362032 1..136 680 100 Plus
Blast to na_te.dros performed on 2019-03-15 21:57:57 has no hits.

AT27602.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:59:12 Download gff for AT27602.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 7248148..7248282 1..135 100 -> Plus
chr2R 7248409..7248732 136..459 100 -> Plus
chr2R 7248965..7249321 460..816 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:25:50 Download gff for AT27602.complete
Subject Subject Range Query Range Percent Splice Strand
san-RA 1..555 128..682 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:50:58 Download gff for AT27602.complete
Subject Subject Range Query Range Percent Splice Strand
san-RA 1..555 128..682 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:03:17 Download gff for AT27602.complete
Subject Subject Range Query Range Percent Splice Strand
san-RA 1..555 128..682 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:42:09 Download gff for AT27602.complete
Subject Subject Range Query Range Percent Splice Strand
san-RA 1..555 128..682 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:07:20 Download gff for AT27602.complete
Subject Subject Range Query Range Percent Splice Strand
san-RA 1..555 128..682 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:04:23 Download gff for AT27602.complete
Subject Subject Range Query Range Percent Splice Strand
san-RA 1..816 1..816 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:50:58 Download gff for AT27602.complete
Subject Subject Range Query Range Percent Splice Strand
san-RA 1..806 11..816 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:03:17 Download gff for AT27602.complete
Subject Subject Range Query Range Percent Splice Strand
san-RA 1..808 9..816 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:42:09 Download gff for AT27602.complete
Subject Subject Range Query Range Percent Splice Strand
san-RA 1..816 1..816 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:07:20 Download gff for AT27602.complete
Subject Subject Range Query Range Percent Splice Strand
san-RA 1..808 9..816 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:59:12 Download gff for AT27602.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11360959..11361282 136..459 99 -> Plus
2R 11361515..11361871 460..816 100   Plus
2R 11360698..11360832 1..135 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:59:12 Download gff for AT27602.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11360959..11361282 136..459 99 -> Plus
2R 11361515..11361871 460..816 100   Plus
2R 11360698..11360832 1..135 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:59:12 Download gff for AT27602.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11360959..11361282 136..459 99 -> Plus
2R 11361515..11361871 460..816 100   Plus
2R 11360698..11360832 1..135 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:03:17 Download gff for AT27602.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 7248203..7248337 1..135 100 -> Plus
arm_2R 7248464..7248787 136..459 99 -> Plus
arm_2R 7249020..7249376 460..816 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:12:48 Download gff for AT27602.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11362158..11362481 136..459 99 -> Plus
2R 11362714..11363070 460..816 100   Plus
2R 11361897..11362031 1..135 100 -> Plus

AT27602.pep Sequence

Translation from 127 to 681

> AT27602.pep
MTRSSIELGDVTPHNIKQLKKLNTVVFPVSYNDKFYVDVLEAGELAKLAY
YNDIVVGAVCCRIDNTENQRRLYIMTLGCLSPYRRLGIGTVMFEHIMNFA
EKDGNFDSIFLHVQINNNGAIEFYKKFGFEIVDTKEQYYKRIEPADAHVL
QKTLRRTAPNSNSTATSTTANSNSRSKARQFTFV*

AT27602.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:38:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12549-PA 184 GF12549-PA 1..184 1..184 858 92.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:38:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20197-PA 184 GG20197-PA 1..184 1..184 969 97.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:38:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21381-PA 179 GH21381-PA 1..177 1..177 832 86.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:18:40
Subject Length Description Subject Range Query Range Score Percent Strand
san-PA 184 CG12352-PA 1..184 1..184 954 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:38:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18558-PA 179 GI18558-PA 1..177 1..177 834 86.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:38:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11686-PA 186 GL11686-PA 1..186 1..184 887 88.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:38:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11576-PA 186 GA11576-PA 1..186 1..184 890 88.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:38:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21284-PA 181 GM21284-PA 1..181 1..184 928 95.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:38:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15393-PA 184 GD15393-PA 1..184 1..184 974 98.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:38:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20352-PA 179 GJ20352-PA 1..177 1..177 836 87 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:38:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23097-PA 115 GK23097-PA 1..115 75..184 414 73 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:38:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12356-PA 184 GE12356-PA 1..184 1..184 965 97.3 Plus

AT27602.hyp Sequence

Translation from 127 to 681

> AT27602.hyp
MTRSSIELGDVTPHNIKQLKKLNTVVFPVSYNDKFYVDVLEAGELAKLAY
YNDIVVGAVCCRIDNTENQRRLYIMTLGCLSPYRRLGIGTVMFEHIMNFA
EKDGNFDSIFLHVQINNNGAIEFYKKFGFEIVDTKEQYYKRIEPADAHVL
QKTLRRTAPNSNSTATSTTANSNSRSKARQFTFV*

AT27602.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:20:07
Subject Length Description Subject Range Query Range Score Percent Strand
san-PA 184 CG12352-PA 1..184 1..184 954 100 Plus