BDGP Sequence Production Resources |
Search the DGRC for AT27602
Library: | AT |
Tissue Source: | Drosophila melanogaster adult testes |
Created by: | Ling Hong |
Date Registered: | 2000-06-08 |
Comments: | Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7 |
Original Plate Number: | 276 |
Well: | 2 |
Vector: | pOTB7 |
Associated Gene/Transcript | san-RA |
Protein status: | AT27602.pep: gold |
Preliminary Size: | 824 |
Sequenced Size: | 845 |
Gene | Date | Evidence |
---|---|---|
CG12352 | 2002-01-01 | Sim4 clustering to Release 2 |
CG12352 | 2002-06-10 | Blastp of sequenced clone |
CG12352 | 2003-01-01 | Sim4 clustering to Release 3 |
san | 2008-04-29 | Release 5.5 accounting |
san | 2008-08-15 | Release 5.9 accounting |
san | 2008-12-18 | 5.12 accounting |
845 bp (845 high quality bases) assembled on 2002-06-10
GenBank Submission: AY070826
> AT27602.complete CGATAACGATAACTTGCGACCTGCAACCCGAACAATCAGGAACAGCTGAG GCGCTTAAAACACATTTTCCTATTACAATTTTCGGCGCAAAGCGCGTTGC TAAATCAACAGAAATCGTACAGACAACATGACTAGGAGCAGCATCGAACT GGGCGACGTGACGCCCCACAACATCAAGCAGCTAAAGAAGCTCAACACCG TGGTTTTCCCGGTCTCCTACAATGACAAGTTTTACGTGGACGTCCTGGAG GCCGGCGAACTGGCCAAATTGGCCTACTACAACGACATTGTAGTGGGCGC CGTCTGCTGTCGCATCGACAACACTGAGAACCAGCGGCGCCTGTATATCA TGACCCTAGGATGCCTCTCCCCGTACCGGCGCCTGGGCATCGGCACAGTT ATGTTCGAGCACATTATGAACTTCGCCGAGAAGGACGGAAACTTCGACAG CATTTTTCTACATGTGCAAATCAACAACAACGGAGCCATCGAGTTCTATA AGAAGTTTGGTTTCGAGATTGTTGACACCAAGGAGCAATACTATAAGCGC ATCGAGCCGGCGGACGCTCATGTACTGCAAAAGACTCTGCGCCGCACTGC ACCCAACTCAAACAGCACCGCCACCAGCACCACCGCGAACTCAAATTCAC GTAGTAAAGCACGACAGTTCACATTTGTTTAAAGATGAATTTCAATATGT ATAACAAACAGACATGTAGAGGCGGCCAAAACGATGTATTCAATTAGTCC GATCATATCTATGTGTAATCAATAATAATTACCCCTGCGCGGGAATAAAT AGCTCTATACGGCTTGAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
san-RA | 1028 | san-RA | 27..842 | 1..816 | 4065 | 99.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 7248965..7249321 | 460..816 | 1785 | 100 | Plus |
chr2R | 21145070 | chr2R | 7248407..7248732 | 134..459 | 1630 | 100 | Plus |
chr2R | 21145070 | chr2R | 7248148..7248283 | 1..136 | 680 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25286936 | 2R | 11361515..11361871 | 460..816 | 1785 | 100 | Plus |
2R | 25286936 | 2R | 11360957..11361282 | 134..459 | 1615 | 99.7 | Plus |
2R | 25286936 | 2R | 11360698..11360833 | 1..136 | 680 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25260384 | 2R | 11362714..11363070 | 460..816 | 1785 | 100 | Plus |
2R | 25260384 | 2R | 11362156..11362481 | 134..459 | 1615 | 99.6 | Plus |
2R | 25260384 | 2R | 11361897..11362032 | 1..136 | 680 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 7248148..7248282 | 1..135 | 100 | -> | Plus |
chr2R | 7248409..7248732 | 136..459 | 100 | -> | Plus |
chr2R | 7248965..7249321 | 460..816 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
san-RA | 1..555 | 128..682 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
san-RA | 1..555 | 128..682 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
san-RA | 1..555 | 128..682 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
san-RA | 1..555 | 128..682 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
san-RA | 1..555 | 128..682 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
san-RA | 1..816 | 1..816 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
san-RA | 1..806 | 11..816 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
san-RA | 1..808 | 9..816 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
san-RA | 1..816 | 1..816 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
san-RA | 1..808 | 9..816 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 11360959..11361282 | 136..459 | 99 | -> | Plus |
2R | 11361515..11361871 | 460..816 | 100 | Plus | |
2R | 11360698..11360832 | 1..135 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 11360959..11361282 | 136..459 | 99 | -> | Plus |
2R | 11361515..11361871 | 460..816 | 100 | Plus | |
2R | 11360698..11360832 | 1..135 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 11360959..11361282 | 136..459 | 99 | -> | Plus |
2R | 11361515..11361871 | 460..816 | 100 | Plus | |
2R | 11360698..11360832 | 1..135 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 7248203..7248337 | 1..135 | 100 | -> | Plus |
arm_2R | 7248464..7248787 | 136..459 | 99 | -> | Plus |
arm_2R | 7249020..7249376 | 460..816 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 11362158..11362481 | 136..459 | 99 | -> | Plus |
2R | 11362714..11363070 | 460..816 | 100 | Plus | |
2R | 11361897..11362031 | 1..135 | 100 | -> | Plus |
Translation from 127 to 681
> AT27602.pep MTRSSIELGDVTPHNIKQLKKLNTVVFPVSYNDKFYVDVLEAGELAKLAY YNDIVVGAVCCRIDNTENQRRLYIMTLGCLSPYRRLGIGTVMFEHIMNFA EKDGNFDSIFLHVQINNNGAIEFYKKFGFEIVDTKEQYYKRIEPADAHVL QKTLRRTAPNSNSTATSTTANSNSRSKARQFTFV*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF12549-PA | 184 | GF12549-PA | 1..184 | 1..184 | 858 | 92.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG20197-PA | 184 | GG20197-PA | 1..184 | 1..184 | 969 | 97.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH21381-PA | 179 | GH21381-PA | 1..177 | 1..177 | 832 | 86.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
san-PA | 184 | CG12352-PA | 1..184 | 1..184 | 954 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI18558-PA | 179 | GI18558-PA | 1..177 | 1..177 | 834 | 86.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL11686-PA | 186 | GL11686-PA | 1..186 | 1..184 | 887 | 88.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA11576-PA | 186 | GA11576-PA | 1..186 | 1..184 | 890 | 88.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM21284-PA | 181 | GM21284-PA | 1..181 | 1..184 | 928 | 95.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD15393-PA | 184 | GD15393-PA | 1..184 | 1..184 | 974 | 98.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ20352-PA | 179 | GJ20352-PA | 1..177 | 1..177 | 836 | 87 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK23097-PA | 115 | GK23097-PA | 1..115 | 75..184 | 414 | 73 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE12356-PA | 184 | GE12356-PA | 1..184 | 1..184 | 965 | 97.3 | Plus |
Translation from 127 to 681
> AT27602.hyp MTRSSIELGDVTPHNIKQLKKLNTVVFPVSYNDKFYVDVLEAGELAKLAY YNDIVVGAVCCRIDNTENQRRLYIMTLGCLSPYRRLGIGTVMFEHIMNFA EKDGNFDSIFLHVQINNNGAIEFYKKFGFEIVDTKEQYYKRIEPADAHVL QKTLRRTAPNSNSTATSTTANSNSRSKARQFTFV*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
san-PA | 184 | CG12352-PA | 1..184 | 1..184 | 954 | 100 | Plus |