BDGP Sequence Production Resources |
Search the DGRC for AT27976
Library: | AT |
Tissue Source: | Drosophila melanogaster adult testes |
Created by: | Ling Hong |
Date Registered: | 2000-06-08 |
Comments: | Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7 |
Original Plate Number: | 279 |
Well: | 76 |
Vector: | pOTB7 |
Associated Gene/Transcript | CG5968-RA |
Protein status: | AT27976.pep: gold |
Preliminary Size: | 586 |
Sequenced Size: | 597 |
Gene | Date | Evidence |
---|---|---|
CG5968 | 2002-01-01 | Sim4 clustering to Release 2 |
CG5968 | 2002-04-21 | Blastp of sequenced clone |
CG5968 | 2003-01-01 | Sim4 clustering to Release 3 |
CG5968 | 2008-04-29 | Release 5.5 accounting |
CG5968 | 2008-08-15 | Release 5.9 accounting |
CG5968 | 2008-12-18 | 5.12 accounting |
597 bp (597 high quality bases) assembled on 2002-04-21
GenBank Submission: AY113314
> AT27976.complete GTAACTCTCAGTTCTTAGAACCGATTTTAGTGATAGCACACGTTTATACA GAATTACACAAATATCGAAAAAAATGCCCAACTTTAATGGGGCTATTATA GTGCACACACTTCAGTTGTTGAAAGCGCCGGCGACACTGCGAGAAATAGT GGTAACCATAGCCAAAAATACGGAATTATCGCAAGATGAGCTTAAAGAGC CTGTGAAACAAACCCTTGAAATGGGCCATCGCTTGGGATTCCTGCAGAAA CTCGACGGTCGCTACTTTTTGATGAATGTGACCTTCGAGACATTGATGTC TGAGATGGAGGCCCTTGACAAAGAAGAATCTCCGGAGAAGTCACTTAAAA AGAAAAAGAAATTAATACCCAAGACTCCTTTATCGTCGGTCGCTGAGAAA AAAATTAATAAGAAGCCAAGTCAAGTCAAGACAACGGAACAGTTGGTAAA GTCAAAACCAACTGAAAAGGGCCGACTGCAGGACATTCCTAGTTCATCCA CAAACATAAGAAAAACGCCATCCAAGCTGATTAAGCGAACAGTTTTTAAG TAAAAGGATATTCGAACTTGTCAAAAAAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 16549351..16549647 | 553..257 | 1485 | 100 | Minus |
2L | 23513712 | 2L | 16549701..16549959 | 259..1 | 1295 | 100 | Minus |
2L | 23513712 | 2L | 16549298..16549343 | 597..552 | 230 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 16548054..16548377 | 258..572 | 96 | <- | Minus |
chr2L | 16548434..16548690 | 1..257 | 98 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5968-RA | 1..480 | 74..553 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5968-RA | 1..480 | 74..553 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5968-RA | 1..480 | 74..553 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5968-RA | 1..480 | 74..553 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5968-RA | 1..480 | 74..553 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5968-RA | 1..581 | 1..572 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5968-RA | 1..581 | 1..572 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5968-RA | 1..581 | 1..572 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5968-RA | 1..581 | 1..572 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5968-RA | 1..581 | 1..572 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 16549703..16549959 | 1..257 | 100 | Minus | |
2L | 16549323..16549646 | 258..572 | 97 | <- | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 16549703..16549959 | 1..257 | 100 | Minus | |
2L | 16549323..16549646 | 258..572 | 97 | <- | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 16549703..16549959 | 1..257 | 100 | Minus | |
2L | 16549323..16549646 | 258..572 | 97 | <- | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 16549323..16549646 | 258..572 | 97 | <- | Minus |
arm_2L | 16549703..16549959 | 1..257 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 16549323..16549646 | 258..572 | 97 | <- | Minus |
2L | 16549703..16549959 | 1..257 | 100 | Minus |
Translation from 73 to 552
> AT27976.hyp MPNFNGAIIVHTLQLLKAPATLREIVVTIAKNTELSQDELKEPVKQTLEM GHRLGFLQKLDGRYFLMNVTFETLMSEMEALDKEESPEKSLKKKKKLIPK TPLSSVAEKKINKKPSQVKTTEQLVKSKPTEKGRLQDIPSSSTNIRKTPS KLIKRTVFK*
Translation from 73 to 552
> AT27976.pep MPNFNGAIIVHTLQLLKAPATLREIVVTIAKNTELSQDELKEPVKQTLEM GHRLGFLQKLDGRYFLMNVTFETLMSEMEALDKEESPEKSLKKKKKLIPK TPLSSVAEKKINKKPSQVKTTEQLVKSKPTEKGRLQDIPSSSTNIRKTPS KLIKRTVFK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF15879-PA | 171 | GF15879-PA | 1..90 | 1..90 | 357 | 73.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG20122-PA | 161 | GG20122-PA | 1..161 | 1..159 | 582 | 76.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH25027-PA | 146 | GH25027-PA | 1..81 | 1..81 | 316 | 66.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG5968-PB | 159 | CG5968-PB | 1..159 | 1..159 | 788 | 100 | Plus |
CG5968-PA | 159 | CG5968-PA | 1..159 | 1..159 | 788 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\Tes41-PA | 170 | GI13803-PA | 1..86 | 1..86 | 340 | 70.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL18476-PA | 145 | GL18476-PA | 1..82 | 1..82 | 329 | 72 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA19266-PA | 145 | GA19266-PA | 1..82 | 1..82 | 328 | 72 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM17171-PA | 159 | GM17171-PA | 1..159 | 1..159 | 658 | 92.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD21908-PA | 159 | GD21908-PA | 1..159 | 1..159 | 658 | 92.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ17451-PA | 170 | GJ17451-PA | 1..80 | 1..80 | 337 | 73.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK21045-PA | 136 | GK21045-PA | 1..129 | 1..124 | 321 | 52.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE13178-PA | 161 | GE13178-PA | 1..161 | 1..159 | 600 | 79.5 | Plus |