Clone AT27976 Report

Search the DGRC for AT27976

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:279
Well:76
Vector:pOTB7
Associated Gene/TranscriptCG5968-RA
Protein status:AT27976.pep: gold
Preliminary Size:586
Sequenced Size:597

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5968 2002-01-01 Sim4 clustering to Release 2
CG5968 2002-04-21 Blastp of sequenced clone
CG5968 2003-01-01 Sim4 clustering to Release 3
CG5968 2008-04-29 Release 5.5 accounting
CG5968 2008-08-15 Release 5.9 accounting
CG5968 2008-12-18 5.12 accounting

Clone Sequence Records

AT27976.complete Sequence

597 bp (597 high quality bases) assembled on 2002-04-21

GenBank Submission: AY113314

> AT27976.complete
GTAACTCTCAGTTCTTAGAACCGATTTTAGTGATAGCACACGTTTATACA
GAATTACACAAATATCGAAAAAAATGCCCAACTTTAATGGGGCTATTATA
GTGCACACACTTCAGTTGTTGAAAGCGCCGGCGACACTGCGAGAAATAGT
GGTAACCATAGCCAAAAATACGGAATTATCGCAAGATGAGCTTAAAGAGC
CTGTGAAACAAACCCTTGAAATGGGCCATCGCTTGGGATTCCTGCAGAAA
CTCGACGGTCGCTACTTTTTGATGAATGTGACCTTCGAGACATTGATGTC
TGAGATGGAGGCCCTTGACAAAGAAGAATCTCCGGAGAAGTCACTTAAAA
AGAAAAAGAAATTAATACCCAAGACTCCTTTATCGTCGGTCGCTGAGAAA
AAAATTAATAAGAAGCCAAGTCAAGTCAAGACAACGGAACAGTTGGTAAA
GTCAAAACCAACTGAAAAGGGCCGACTGCAGGACATTCCTAGTTCATCCA
CAAACATAAGAAAAACGCCATCCAAGCTGATTAAGCGAACAGTTTTTAAG
TAAAAGGATATTCGAACTTGTCAAAAAAAAAAAAAAAAAAAAAAAAA

AT27976.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:55:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG5968-RA 786 CG5968-RA 64..616 1..553 2765 100 Plus
CG5968-RA 786 CG5968-RA 624..669 552..597 230 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:37:35
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 16548082..16548378 553..257 1470 99.7 Minus
chr2L 23010047 chr2L 16548432..16548690 259..1 1250 98.8 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:00:49 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:37:34
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 16549298..16549647 597..257 1580 97.4 Minus
2L 23513712 2L 16549701..16549959 259..1 1295 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:14:51
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 16549351..16549647 553..257 1485 100 Minus
2L 23513712 2L 16549701..16549959 259..1 1295 100 Minus
2L 23513712 2L 16549298..16549343 597..552 230 100 Minus
Blast to na_te.dros performed on 2019-03-16 13:37:34 has no hits.

AT27976.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:38:26 Download gff for AT27976.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 16548054..16548377 258..572 96 <- Minus
chr2L 16548434..16548690 1..257 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:26:19 Download gff for AT27976.complete
Subject Subject Range Query Range Percent Splice Strand
CG5968-RA 1..480 74..553 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:53:30 Download gff for AT27976.complete
Subject Subject Range Query Range Percent Splice Strand
CG5968-RA 1..480 74..553 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:01:37 Download gff for AT27976.complete
Subject Subject Range Query Range Percent Splice Strand
CG5968-RA 1..480 74..553 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:35:59 Download gff for AT27976.complete
Subject Subject Range Query Range Percent Splice Strand
CG5968-RA 1..480 74..553 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:15:41 Download gff for AT27976.complete
Subject Subject Range Query Range Percent Splice Strand
CG5968-RA 1..480 74..553 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:05:46 Download gff for AT27976.complete
Subject Subject Range Query Range Percent Splice Strand
CG5968-RA 1..581 1..572 98   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:53:30 Download gff for AT27976.complete
Subject Subject Range Query Range Percent Splice Strand
CG5968-RA 1..581 1..572 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:01:37 Download gff for AT27976.complete
Subject Subject Range Query Range Percent Splice Strand
CG5968-RA 1..581 1..572 98   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:35:59 Download gff for AT27976.complete
Subject Subject Range Query Range Percent Splice Strand
CG5968-RA 1..581 1..572 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:15:41 Download gff for AT27976.complete
Subject Subject Range Query Range Percent Splice Strand
CG5968-RA 1..581 1..572 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:38:26 Download gff for AT27976.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16549703..16549959 1..257 100   Minus
2L 16549323..16549646 258..572 97 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:38:26 Download gff for AT27976.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16549703..16549959 1..257 100   Minus
2L 16549323..16549646 258..572 97 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:38:26 Download gff for AT27976.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16549703..16549959 1..257 100   Minus
2L 16549323..16549646 258..572 97 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:01:37 Download gff for AT27976.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 16549323..16549646 258..572 97 <- Minus
arm_2L 16549703..16549959 1..257 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:18:31 Download gff for AT27976.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16549323..16549646 258..572 97 <- Minus
2L 16549703..16549959 1..257 100   Minus

AT27976.hyp Sequence

Translation from 73 to 552

> AT27976.hyp
MPNFNGAIIVHTLQLLKAPATLREIVVTIAKNTELSQDELKEPVKQTLEM
GHRLGFLQKLDGRYFLMNVTFETLMSEMEALDKEESPEKSLKKKKKLIPK
TPLSSVAEKKINKKPSQVKTTEQLVKSKPTEKGRLQDIPSSSTNIRKTPS
KLIKRTVFK*

AT27976.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:20:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG5968-PB 159 CG5968-PB 1..159 1..159 788 100 Plus
CG5968-PA 159 CG5968-PA 1..159 1..159 788 100 Plus

AT27976.pep Sequence

Translation from 73 to 552

> AT27976.pep
MPNFNGAIIVHTLQLLKAPATLREIVVTIAKNTELSQDELKEPVKQTLEM
GHRLGFLQKLDGRYFLMNVTFETLMSEMEALDKEESPEKSLKKKKKLIPK
TPLSSVAEKKINKKPSQVKTTEQLVKSKPTEKGRLQDIPSSSTNIRKTPS
KLIKRTVFK*

AT27976.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 13:55:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15879-PA 171 GF15879-PA 1..90 1..90 357 73.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:55:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20122-PA 161 GG20122-PA 1..161 1..159 582 76.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 13:55:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH25027-PA 146 GH25027-PA 1..81 1..81 316 66.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:11:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG5968-PB 159 CG5968-PB 1..159 1..159 788 100 Plus
CG5968-PA 159 CG5968-PA 1..159 1..159 788 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 13:55:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\Tes41-PA 170 GI13803-PA 1..86 1..86 340 70.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 13:55:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18476-PA 145 GL18476-PA 1..82 1..82 329 72 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 13:55:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19266-PA 145 GA19266-PA 1..82 1..82 328 72 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:55:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17171-PA 159 GM17171-PA 1..159 1..159 658 92.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:55:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21908-PA 159 GD21908-PA 1..159 1..159 658 92.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 13:55:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17451-PA 170 GJ17451-PA 1..80 1..80 337 73.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 13:55:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21045-PA 136 GK21045-PA 1..129 1..124 321 52.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:55:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13178-PA 161 GE13178-PA 1..161 1..159 600 79.5 Plus