BDGP Sequence Production Resources |
Search the DGRC for AT27980
Library: | AT |
Tissue Source: | Drosophila melanogaster adult testes |
Created by: | Ling Hong |
Date Registered: | 2000-06-08 |
Comments: | Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7 |
Original Plate Number: | 279 |
Well: | 80 |
Vector: | pOTB7 |
Associated Gene/Transcript | RpL27-RA |
Protein status: | AT27980.pep: gold |
Preliminary Size: | 808 |
Sequenced Size: | 585 |
Gene | Date | Evidence |
---|---|---|
CG4759 | 2001-12-16 | Blastp of sequenced clone |
CG4759 | 2002-01-01 | Sim4 clustering to Release 2 |
CG4759 | 2003-01-01 | Sim4 clustering to Release 3 |
RpL27 | 2008-04-29 | Release 5.5 accounting |
RpL27 | 2008-08-15 | Release 5.9 accounting |
RpL27 | 2008-12-18 | 5.12 accounting |
585 bp (585 high quality bases) assembled on 2001-12-16
GenBank Submission: AY070827
> AT27980.complete AAGACGACGTTTTGCCATCTCTAAAATCTCCCCTTCTTTTCTTTTCGCCC GTTTCCGAGCAAACCGCCAAGATGAGGAAAATCATGAAGCAGGGCAAGAT CGTAATCGTCCTTAGCGGACGTTACGCCGGTCGCAAGGCCATCATCGTCA AGACCCACGACGATGGAACCCCGGAGAAGCCCTTCGGACACGCCCTCGTC GCCGGTATCGATCGCTACCCGCGCAAGGTGACCAAGAAGATGGGCAAGAA CAAGCTGAAGAAGAAGTCCAAGGTCAAGCCCTTCCTGAAGAGCCTGAACT ACAATCATCTGATGCCCACCCGCTACACGGCGCACGACATCAGCTTTGAG AAGCTGTCGCCCAAGGACCTGAAGGATCCCGTAAAGCGCAAGACGCACCG CTTCCAGACCCGCGTCAAGTTCGAGTCCGTCTACAAGGAGGGCAAGAACA AGTGGTTCTTCCAGAAGCTGCGTTTCTAAGCTGCCCATTCGCTACTTGTG GTTACTGGATTTGTCGCTCTTTTTTAAGGTTTAATAAACAAAGAAGTAAT TCTGATAAAACTGACCGAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
RpL27-RA | 980 | RpL27-RA | 30..598 | 1..569 | 2845 | 100 | Plus |
RpL27.b | 1027 | RpL27.b | 132..645 | 56..569 | 2570 | 100 | Plus |
RpL27.a | 853 | RpL27.a | 74..586 | 57..569 | 2565 | 100 | Plus |
RpL27.b | 1027 | RpL27.b | 11..67 | 1..57 | 285 | 100 | Plus |
RpL27.a | 853 | RpL27.a | 11..67 | 1..57 | 285 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 21507041..21507550 | 58..567 | 100 | <- | Minus |
chr3R | 21508059..21508115 | 1..57 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL27-RA | 1..408 | 72..479 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL27-RA | 1..408 | 72..479 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL27-RB | 1..408 | 72..479 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL27-RA | 1..408 | 72..479 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL27-RB | 1..408 | 72..479 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL27-RA | 11..577 | 1..567 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL27-RA | 11..577 | 1..567 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL27-RA | 1..537 | 31..567 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL27-RA | 11..577 | 1..567 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL27-RA | 1..537 | 31..567 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 25684007..25684516 | 58..567 | 100 | <- | Minus |
3R | 25685025..25685081 | 1..57 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 25684007..25684516 | 58..567 | 100 | <- | Minus |
3R | 25685025..25685081 | 1..57 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 25684007..25684516 | 58..567 | 100 | <- | Minus |
3R | 25685025..25685081 | 1..57 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 21509729..21510238 | 58..567 | 100 | <- | Minus |
arm_3R | 21510747..21510803 | 1..57 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 25424838..25425347 | 58..567 | 100 | <- | Minus |
3R | 25425856..25425912 | 1..57 | 100 | Minus |
Translation from 2 to 478
> AT27980.hyp DDVLPSLKSPLLFFSPVSEQTAKMRKIMKQGKIVIVLSGRYAGRKAIIVK THDDGTPEKPFGHALVAGIDRYPRKVTKKMGKNKLKKKSKVKPFLKSLNY NHLMPTRYTAHDISFEKLSPKDLKDPVKRKTHRFQTRVKFESVYKEGKNK WFFQKLRF*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
RpL27-PD | 135 | CG4759-PD | 1..135 | 24..158 | 710 | 100 | Plus |
RpL27-PC | 135 | CG4759-PC | 1..135 | 24..158 | 710 | 100 | Plus |
RpL27-PB | 135 | CG4759-PB | 1..135 | 24..158 | 710 | 100 | Plus |
RpL27-PA | 135 | CG4759-PA | 1..135 | 24..158 | 710 | 100 | Plus |
Translation from 71 to 478
> AT27980.pep MRKIMKQGKIVIVLSGRYAGRKAIIVKTHDDGTPEKPFGHALVAGIDRYP RKVTKKMGKNKLKKKSKVKPFLKSLNYNHLMPTRYTAHDISFEKLSPKDL KDPVKRKTHRFQTRVKFESVYKEGKNKWFFQKLRF*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF18237-PA | 135 | GF18237-PA | 1..135 | 1..135 | 691 | 99.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG12227-PA | 135 | GG12227-PA | 1..135 | 1..135 | 699 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH18602-PA | 135 | GH18602-PA | 1..135 | 1..135 | 695 | 98.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
RpL27-PD | 135 | CG4759-PD | 1..135 | 1..135 | 710 | 100 | Plus |
RpL27-PC | 135 | CG4759-PC | 1..135 | 1..135 | 710 | 100 | Plus |
RpL27-PB | 135 | CG4759-PB | 1..135 | 1..135 | 710 | 100 | Plus |
RpL27-PA | 135 | CG4759-PA | 1..135 | 1..135 | 710 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI10350-PA | 135 | GI10350-PA | 1..135 | 1..135 | 690 | 98.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL22302-PA | 135 | GL22302-PA | 1..135 | 1..135 | 689 | 97.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA18411-PA | 135 | GA18411-PA | 1..135 | 1..135 | 689 | 97.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM10227-PA | 135 | GM10227-PA | 1..135 | 1..135 | 699 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD18180-PA | 135 | GD18180-PA | 1..135 | 1..135 | 699 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ10202-PA | 135 | GJ10202-PA | 1..135 | 1..135 | 690 | 98.5 | Plus |
Dvir\GJ21258-PA | 138 | GJ21258-PA | 3..138 | 1..135 | 495 | 70.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK14392-PA | 135 | GK14392-PA | 1..135 | 1..135 | 688 | 97.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE10675-PA | 135 | GE10675-PA | 1..135 | 1..135 | 699 | 100 | Plus |