Clone AT27980 Report

Search the DGRC for AT27980

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:279
Well:80
Vector:pOTB7
Associated Gene/TranscriptRpL27-RA
Protein status:AT27980.pep: gold
Preliminary Size:808
Sequenced Size:585

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4759 2001-12-16 Blastp of sequenced clone
CG4759 2002-01-01 Sim4 clustering to Release 2
CG4759 2003-01-01 Sim4 clustering to Release 3
RpL27 2008-04-29 Release 5.5 accounting
RpL27 2008-08-15 Release 5.9 accounting
RpL27 2008-12-18 5.12 accounting

Clone Sequence Records

AT27980.complete Sequence

585 bp (585 high quality bases) assembled on 2001-12-16

GenBank Submission: AY070827

> AT27980.complete
AAGACGACGTTTTGCCATCTCTAAAATCTCCCCTTCTTTTCTTTTCGCCC
GTTTCCGAGCAAACCGCCAAGATGAGGAAAATCATGAAGCAGGGCAAGAT
CGTAATCGTCCTTAGCGGACGTTACGCCGGTCGCAAGGCCATCATCGTCA
AGACCCACGACGATGGAACCCCGGAGAAGCCCTTCGGACACGCCCTCGTC
GCCGGTATCGATCGCTACCCGCGCAAGGTGACCAAGAAGATGGGCAAGAA
CAAGCTGAAGAAGAAGTCCAAGGTCAAGCCCTTCCTGAAGAGCCTGAACT
ACAATCATCTGATGCCCACCCGCTACACGGCGCACGACATCAGCTTTGAG
AAGCTGTCGCCCAAGGACCTGAAGGATCCCGTAAAGCGCAAGACGCACCG
CTTCCAGACCCGCGTCAAGTTCGAGTCCGTCTACAAGGAGGGCAAGAACA
AGTGGTTCTTCCAGAAGCTGCGTTTCTAAGCTGCCCATTCGCTACTTGTG
GTTACTGGATTTGTCGCTCTTTTTTAAGGTTTAATAAACAAAGAAGTAAT
TCTGATAAAACTGACCGAAAAAAAAAAAAAAAAAA

AT27980.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:37:39
Subject Length Description Subject Range Query Range Score Percent Strand
RpL27-RA 980 RpL27-RA 30..598 1..569 2845 100 Plus
RpL27.b 1027 RpL27.b 132..645 56..569 2570 100 Plus
RpL27.a 853 RpL27.a 74..586 57..569 2565 100 Plus
RpL27.b 1027 RpL27.b 11..67 1..57 285 100 Plus
RpL27.a 853 RpL27.a 11..67 1..57 285 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 10:03:37
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 21507041..21507551 567..57 2555 100 Minus
chr3R 27901430 chr3R 21508059..21508115 57..1 285 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:00:50 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 10:03:35
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 25684005..25684517 569..57 2565 100 Minus
3R 32079331 3R 25685025..25685081 57..1 285 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:05:01
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 25424836..25425348 569..57 2565 100 Minus
3R 31820162 3R 25425856..25425912 57..1 285 100 Minus
Blast to na_te.dros performed on 2019-03-16 10:03:35 has no hits.

AT27980.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 10:04:46 Download gff for AT27980.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 21507041..21507550 58..567 100 <- Minus
chr3R 21508059..21508115 1..57 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:26:20 Download gff for AT27980.complete
Subject Subject Range Query Range Percent Splice Strand
RpL27-RA 1..408 72..479 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:01:07 Download gff for AT27980.complete
Subject Subject Range Query Range Percent Splice Strand
RpL27-RA 1..408 72..479 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:54:56 Download gff for AT27980.complete
Subject Subject Range Query Range Percent Splice Strand
RpL27-RB 1..408 72..479 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:25:43 Download gff for AT27980.complete
Subject Subject Range Query Range Percent Splice Strand
RpL27-RA 1..408 72..479 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:53:24 Download gff for AT27980.complete
Subject Subject Range Query Range Percent Splice Strand
RpL27-RB 1..408 72..479 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:27:21 Download gff for AT27980.complete
Subject Subject Range Query Range Percent Splice Strand
RpL27-RA 11..577 1..567 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:01:07 Download gff for AT27980.complete
Subject Subject Range Query Range Percent Splice Strand
RpL27-RA 11..577 1..567 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:54:56 Download gff for AT27980.complete
Subject Subject Range Query Range Percent Splice Strand
RpL27-RA 1..537 31..567 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:25:44 Download gff for AT27980.complete
Subject Subject Range Query Range Percent Splice Strand
RpL27-RA 11..577 1..567 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:53:24 Download gff for AT27980.complete
Subject Subject Range Query Range Percent Splice Strand
RpL27-RA 1..537 31..567 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:04:46 Download gff for AT27980.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25684007..25684516 58..567 100 <- Minus
3R 25685025..25685081 1..57 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:04:46 Download gff for AT27980.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25684007..25684516 58..567 100 <- Minus
3R 25685025..25685081 1..57 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:04:46 Download gff for AT27980.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25684007..25684516 58..567 100 <- Minus
3R 25685025..25685081 1..57 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:54:56 Download gff for AT27980.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 21509729..21510238 58..567 100 <- Minus
arm_3R 21510747..21510803 1..57 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:01:16 Download gff for AT27980.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25424838..25425347 58..567 100 <- Minus
3R 25425856..25425912 1..57 100   Minus

AT27980.hyp Sequence

Translation from 2 to 478

> AT27980.hyp
DDVLPSLKSPLLFFSPVSEQTAKMRKIMKQGKIVIVLSGRYAGRKAIIVK
THDDGTPEKPFGHALVAGIDRYPRKVTKKMGKNKLKKKSKVKPFLKSLNY
NHLMPTRYTAHDISFEKLSPKDLKDPVKRKTHRFQTRVKFESVYKEGKNK
WFFQKLRF*

AT27980.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:20:47
Subject Length Description Subject Range Query Range Score Percent Strand
RpL27-PD 135 CG4759-PD 1..135 24..158 710 100 Plus
RpL27-PC 135 CG4759-PC 1..135 24..158 710 100 Plus
RpL27-PB 135 CG4759-PB 1..135 24..158 710 100 Plus
RpL27-PA 135 CG4759-PA 1..135 24..158 710 100 Plus

AT27980.pep Sequence

Translation from 71 to 478

> AT27980.pep
MRKIMKQGKIVIVLSGRYAGRKAIIVKTHDDGTPEKPFGHALVAGIDRYP
RKVTKKMGKNKLKKKSKVKPFLKSLNYNHLMPTRYTAHDISFEKLSPKDL
KDPVKRKTHRFQTRVKFESVYKEGKNKWFFQKLRF*

AT27980.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:16:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18237-PA 135 GF18237-PA 1..135 1..135 691 99.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:16:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12227-PA 135 GG12227-PA 1..135 1..135 699 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:16:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18602-PA 135 GH18602-PA 1..135 1..135 695 98.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:05:39
Subject Length Description Subject Range Query Range Score Percent Strand
RpL27-PD 135 CG4759-PD 1..135 1..135 710 100 Plus
RpL27-PC 135 CG4759-PC 1..135 1..135 710 100 Plus
RpL27-PB 135 CG4759-PB 1..135 1..135 710 100 Plus
RpL27-PA 135 CG4759-PA 1..135 1..135 710 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:16:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10350-PA 135 GI10350-PA 1..135 1..135 690 98.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:16:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22302-PA 135 GL22302-PA 1..135 1..135 689 97.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:16:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18411-PA 135 GA18411-PA 1..135 1..135 689 97.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:16:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10227-PA 135 GM10227-PA 1..135 1..135 699 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:16:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18180-PA 135 GD18180-PA 1..135 1..135 699 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:16:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10202-PA 135 GJ10202-PA 1..135 1..135 690 98.5 Plus
Dvir\GJ21258-PA 138 GJ21258-PA 3..138 1..135 495 70.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:16:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14392-PA 135 GK14392-PA 1..135 1..135 688 97.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:16:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10675-PA 135 GE10675-PA 1..135 1..135 699 100 Plus