Clone AT28833 Report

Search the DGRC for AT28833

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:288
Well:33
Vector:pOTB7
Associated Gene/TranscriptRpL24-like-RA
Protein status:AT28833.pep: gold
Preliminary Size:701
Sequenced Size:885

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6764 2002-01-01 Sim4 clustering to Release 2
CG6764 2002-04-21 Blastp of sequenced clone
CG6764 2003-01-01 Sim4 clustering to Release 3
CG6764 2008-04-29 Release 5.5 accounting
CG6764 2008-08-15 Release 5.9 accounting
CG6764 2008-12-18 5.12 accounting

Clone Sequence Records

AT28833.complete Sequence

885 bp (885 high quality bases) assembled on 2002-04-21

GenBank Submission: AY113325

> AT28833.complete
CTTGCTTGGATATTTTTTGTCTACATCTAGCTATTTTCCATGTTAGCCAG
TGTTATCGATAAGCAGTGACTGGTCGCACTGCTGACTGCCGATACATTTT
CATATTTCTTCTTCTTCAGCAGCACACGTGCTAGCAGCTTGCGCATTTGT
TTTGTTTTCGTAATTTATCCGTCGTAAATTGCGAAAATGCGCATTCAAAC
GTGCTATTTTTGCTCTAGCAAAATATACCCGGGCCACGGGGTGCAATTCG
TGCGAAATGACTGCAAGGTCTTCAAGTTCTGCCGAGGCAAGTGTCACAAG
GCCTTTAAGCGCAAGAAGAATCCCCGCAAGGTAGGATGGACGAAGGCGTA
CCGCAAGGCCGCCGGCAAGGAGCTGGCCATCGATCCCAGTTTCGAGTTCG
AGAAGCGCCGCAACGTGCCCATGAAATACAGCCGCGAGACCTGGCAGAAG
GGTCTGGAGGCCATCAAGCGGGTGACGGAGATTAAGGAGAAACGCACCAG
CCACTTTGTCATGGAGCGACTGCGCAAGGGTCGCCAGGTCGAGATTCAGA
TGGACGTCAAGGATGTGCAGCGCAACATGTCCCTGATTCGCTCCCCAGCC
GCAGGGCTGAAGCAACGACGTGCCCAGGAGGCGGCAGAGGAGGCCGCCCT
CATGGAGGAGGATCTGCCCGAGGAGAAGATCACCTACGTGGATGCACGCG
AACTCGAGAAGAAACTGGAGGAGGGAATGGGGGTCGAGGATCTCGAGATG
TTAGAAGCCTAAGGACGAGTACGCTGATTTTTTCTTAGTTTAAGTTGCTG
CTAAAAAATACATTATATAAAAACCCCGTGGTACATAAATGTTGTCTTTG
GTTGTTATATATTTTCAAAAAAAAAAAAAAAAAAA

AT28833.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:14:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG6764-RA 903 CG6764-RA 1..869 1..869 4345 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 22:23:32
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 7256210..7256810 866..266 3005 100 Minus
chr3R 27901430 chr3R 7256877..7257145 269..1 1345 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:01:45 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 22:23:30
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 11430737..11431340 869..266 3020 100 Minus
3R 32079331 3R 11431407..11431675 269..1 1345 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:44:36
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 11171568..11172171 869..266 3020 100 Minus
3R 31820162 3R 11172238..11172506 269..1 1345 100 Minus
Blast to na_te.dros performed on 2019-03-15 22:23:31 has no hits.

AT28833.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:24:36 Download gff for AT28833.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 7256210..7256808 268..866 100 <- Minus
chr3R 7256879..7257145 1..267 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:28:28 Download gff for AT28833.complete
Subject Subject Range Query Range Percent Splice Strand
CG6764-RA 1..576 187..762 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:00:30 Download gff for AT28833.complete
Subject Subject Range Query Range Percent Splice Strand
RpL24-like-RA 1..576 187..762 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:17:39 Download gff for AT28833.complete
Subject Subject Range Query Range Percent Splice Strand
RpL24-like-RA 1..576 187..762 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:53:49 Download gff for AT28833.complete
Subject Subject Range Query Range Percent Splice Strand
CG6764-RA 1..576 187..762 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:20:28 Download gff for AT28833.complete
Subject Subject Range Query Range Percent Splice Strand
RpL24-like-RA 1..576 187..762 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:41:34 Download gff for AT28833.complete
Subject Subject Range Query Range Percent Splice Strand
CG6764-RA 1..866 1..866 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:00:30 Download gff for AT28833.complete
Subject Subject Range Query Range Percent Splice Strand
RpL24-like-RA 1..866 1..866 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:17:39 Download gff for AT28833.complete
Subject Subject Range Query Range Percent Splice Strand
RpL24-like-RA 1..773 94..866 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:53:49 Download gff for AT28833.complete
Subject Subject Range Query Range Percent Splice Strand
CG6764-RA 1..866 1..866 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:20:28 Download gff for AT28833.complete
Subject Subject Range Query Range Percent Splice Strand
RpL24-like-RA 1..773 94..866 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:24:36 Download gff for AT28833.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11430740..11431338 268..866 100 <- Minus
3R 11431409..11431675 1..267 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:24:36 Download gff for AT28833.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11430740..11431338 268..866 100 <- Minus
3R 11431409..11431675 1..267 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:24:36 Download gff for AT28833.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11430740..11431338 268..866 100 <- Minus
3R 11431409..11431675 1..267 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:17:39 Download gff for AT28833.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 7256462..7257060 268..866 100 <- Minus
arm_3R 7257131..7257397 1..267 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:26:00 Download gff for AT28833.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11171571..11172169 268..866 100 <- Minus
3R 11172240..11172506 1..267 100   Minus

AT28833.pep Sequence

Translation from 186 to 761

> AT28833.pep
MRIQTCYFCSSKIYPGHGVQFVRNDCKVFKFCRGKCHKAFKRKKNPRKVG
WTKAYRKAAGKELAIDPSFEFEKRRNVPMKYSRETWQKGLEAIKRVTEIK
EKRTSHFVMERLRKGRQVEIQMDVKDVQRNMSLIRSPAAGLKQRRAQEAA
EEAALMEEDLPEEKITYVDARELEKKLEEGMGVEDLEMLEA*

AT28833.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 01:47:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18157-PA 191 GF18157-PA 1..191 1..191 894 92.1 Plus
Dana\GF21662-PA 155 GF21662-PA 1..57 1..57 154 49.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 01:47:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17222-PA 191 GG17222-PA 1..191 1..191 908 94.2 Plus
Dere\GG10203-PA 154 GG10203-PA 1..56 2..57 150 50 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 01:47:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23979-PA 191 GH23979-PA 1..191 1..191 844 87.4 Plus
Dgri\GH11098-PA 155 GH11098-PA 1..57 1..57 154 49.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:31:16
Subject Length Description Subject Range Query Range Score Percent Strand
RpL24-like-PA 191 CG6764-PA 1..191 1..191 994 100 Plus
RpL24-PC 155 CG9282-PC 1..142 1..151 172 30.5 Plus
RpL24-PB 155 CG9282-PB 1..142 1..151 172 30.5 Plus
RpL24-PA 155 CG9282-PA 1..142 1..151 172 30.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 01:47:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10058-PA 191 GI10058-PA 1..191 1..191 787 85.3 Plus
Dmoj\GI18222-PA 155 GI18222-PA 1..57 1..57 154 49.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 01:47:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12604-PA 192 GL12604-PA 1..192 1..191 864 89.1 Plus
Dper\GL25708-PA 155 GL25708-PA 1..57 1..57 136 43.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 01:47:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19846-PA 192 GA19846-PA 1..192 1..191 864 89.1 Plus
Dpse\GA22528-PA 155 GA22528-PA 1..57 1..57 152 49.1 Plus
Dpse\GA21667-PA 155 GA21667-PA 1..57 1..57 152 49.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 01:47:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26099-PA 191 GM26099-PA 1..191 1..191 1000 97.9 Plus
Dsec\GM25565-PA 155 GM25565-PA 1..57 1..57 152 49.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 01:47:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20660-PA 191 GD20660-PA 1..191 1..191 996 97.4 Plus
Dsim\GD22063-PA 155 GD22063-PA 1..57 1..57 152 49.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 01:47:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23794-PA 191 GJ23794-PA 1..191 1..191 778 85.9 Plus
Dvir\GJ18129-PA 155 GJ18129-PA 1..57 1..57 154 49.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 01:47:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11794-PA 191 GK11794-PA 1..191 1..191 877 90.6 Plus
Dwil\GK15282-PA 155 GK15282-PA 1..57 1..57 153 49.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 01:47:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24623-PA 191 GE24623-PA 1..191 1..191 898 92.7 Plus

AT28833.hyp Sequence

Translation from 186 to 761

> AT28833.hyp
MRIQTCYFCSSKIYPGHGVQFVRNDCKVFKFCRGKCHKAFKRKKNPRKVG
WTKAYRKAAGKELAIDPSFEFEKRRNVPMKYSRETWQKGLEAIKRVTEIK
EKRTSHFVMERLRKGRQVEIQMDVKDVQRNMSLIRSPAAGLKQRRAQEAA
EEAALMEEDLPEEKITYVDARELEKKLEEGMGVEDLEMLEA*

AT28833.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:22:17
Subject Length Description Subject Range Query Range Score Percent Strand
RpL24-like-PA 191 CG6764-PA 1..191 1..191 994 100 Plus
RpL24-PC 155 CG9282-PC 1..142 1..151 172 30.5 Plus
RpL24-PB 155 CG9282-PB 1..142 1..151 172 30.5 Plus
RpL24-PA 155 CG9282-PA 1..142 1..151 172 30.5 Plus