Clone AT28918 Report

Search the DGRC for AT28918

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:289
Well:18
Vector:pOTB7
Associated Gene/Transcriptms(2)35Ci-RA
Protein status:AT28918.pep: gold
Sequenced Size:1015

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15262 2002-01-01 Sim4 clustering to Release 2
CG31733 2002-04-21 Blastp of sequenced clone
CG31733 2003-01-01 Sim4 clustering to Release 3
ms(2)35Ci 2008-04-29 Release 5.5 accounting
ms(2)35Ci 2008-08-15 Release 5.9 accounting
ms(2)35Ci 2008-12-18 5.12 accounting

Clone Sequence Records

AT28918.complete Sequence

1015 bp (1015 high quality bases) assembled on 2002-04-21

GenBank Submission: AY113326

> AT28918.complete
GGAAAGTCCGGCAATCCGCATAAATTCAAAGGAGTTCCTTCGAAAAATTG
TCAAATGTTGTAGGGTCCTCGGATACCTGGCAACAGAAATGGAGCTCGGA
AGAGACTTCATCAAAAGGACGTTAGAATTGTCACAATGCCAATAATCAAG
AAGTTCTGCTATTGTTTTAGTCTAAGAATTGGCGCATTTTCAATTGCGTA
CGCAGGTCTTACAATGGATGTATTAGATACAGTAGCGACTATATATACTA
AGTCGCAATATTGCGCTGATATACTACTCCTCTGGATAATTTCCACCATT
TGGAATATCATTTCCGCATTGGTTCTTTTGACTGCACTTTTTCGGGAAAA
TCCGCATTTGCTGCCAGTTCATCTGGTGACTTCTCTTTGTGGCCTGATGC
TCGAAATGACCAATCACATGGTGATTGCCTCCCTTGGCAGAACCGATTAC
GTTTTGATATCCTATGCGTTCATTATGATTGCCTTTGTATCTGCGGACGT
CGTGATCGTGCTGAGCTACTACCAATCGGAGGTTTAGTGAACCACTCCGA
TTACCCATTAACCCAGGCAACCGACCGGGCGCAGCATGTAGCATTTTGTG
GTGCGCGATTAGGCGCGAAAATTTATTTGGAAAATGTTGCGCAATCCGCG
CCGTGCATAAATCGTGGCCAATTGTCACCAGCGGATTGGCAACCGAACCT
CAGCGACCTGCGTTTAATTATCGCCCCGCCAGCGCCCGCCGAGCTACATG
CGTGCTAATTGACCAGGCTGCAGCTCAACGCTGCTCCAATCCGAAATCCG
AATACGAATCCGACTCCAAATGTCCAAATGATAACCGCGACGATGAAAAC
GCATGCTGAGCCAAATGAAAATTATGTTGCAATGGGGCAGGCGTGCTGCT
CGCTGGCTGGTCAGTGAACCGCAGTTTGCACCACCATCCATCCATGGGGC
TTAATTAATTTCCTTGATTAATTGAAAGTGCGCCTTGCTCGCAGTAAAAA
AAAAAAAAAAAAAAA

AT28918.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:14:11
Subject Length Description Subject Range Query Range Score Percent Strand
ms(2)35Ci-RA 1171 ms(2)35Ci-RA 78..894 1..817 4070 99.8 Plus
ms(2)35Ci.a 1489 ms(2)35Ci.a 78..894 1..817 4070 99.8 Plus
ms(2)35Ci-RA 1171 ms(2)35Ci-RA 947..1128 815..996 910 100 Plus
ms(2)35Ci.a 1489 ms(2)35Ci.a 947..1128 815..996 910 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 12:44:34
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 15291991..15292323 485..817 1665 100 Plus
chr2L 23010047 chr2L 15291514..15291729 131..346 1065 99.5 Plus
chr2L 23010047 chr2L 15292376..15292556 815..995 905 100 Plus
chr2L 23010047 chr2L 15291785..15291929 340..484 710 99.3 Plus
chr2L 23010047 chr2L 15291327..15291460 1..134 670 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:01:48 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 12:44:32
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 15293209..15293541 485..817 1665 100 Plus
2L 23513712 2L 15292732..15292947 131..346 1065 99.5 Plus
2L 23513712 2L 15293594..15293775 815..996 910 100 Plus
2L 23513712 2L 15293003..15293147 340..484 710 99.3 Plus
2L 23513712 2L 15292545..15292678 1..134 655 99.3 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:44:27
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 15293209..15293541 485..817 1665 100 Plus
2L 23513712 2L 15292732..15292947 131..346 1065 99.5 Plus
2L 23513712 2L 15293594..15293775 815..996 910 100 Plus
2L 23513712 2L 15293003..15293147 340..484 710 99.3 Plus
2L 23513712 2L 15292545..15292678 1..134 655 99.2 Plus
Blast to na_te.dros performed on 2019-03-15 12:44:33 has no hits.

AT28918.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 12:45:45 Download gff for AT28918.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 15291327..15291460 1..134 100 -> Plus
chr2L 15291518..15291728 135..345 100 -> Plus
chr2L 15291791..15291929 346..484 100 -> Plus
chr2L 15291991..15292325 485..819 99 -> Plus
chr2L 15292381..15292556 820..995 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:28:40 Download gff for AT28918.complete
Subject Subject Range Query Range Percent Splice Strand
ms(2)35Ci-RB 1..627 136..758 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:00:17 Download gff for AT28918.complete
Subject Subject Range Query Range Percent Splice Strand
ms(2)35Ci-RA 1..402 136..537 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:49:04 Download gff for AT28918.complete
Subject Subject Range Query Range Percent Splice Strand
ms(2)35Ci-RA 1..402 136..537 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:53:33 Download gff for AT28918.complete
Subject Subject Range Query Range Percent Splice Strand
ms(2)35Ci-RB 1..627 136..758 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:08:32 Download gff for AT28918.complete
Subject Subject Range Query Range Percent Splice Strand
ms(2)35Ci-RA 1..402 136..537 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:41:16 Download gff for AT28918.complete
Subject Subject Range Query Range Percent Splice Strand
ms(2)35Ci-RB 1..823 1..819 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:00:17 Download gff for AT28918.complete
Subject Subject Range Query Range Percent Splice Strand
ms(2)35Ci-RA 1..819 1..819 99 <- Plus
ms(2)35Ci-RA 875..1050 820..995 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:49:04 Download gff for AT28918.complete
Subject Subject Range Query Range Percent Splice Strand
ms(2)35Ci-RA 78..896 1..819 99 <- Plus
ms(2)35Ci-RA 952..1127 820..995 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:53:33 Download gff for AT28918.complete
Subject Subject Range Query Range Percent Splice Strand
ms(2)35Ci-RB 1..823 1..819 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:08:32 Download gff for AT28918.complete
Subject Subject Range Query Range Percent Splice Strand
ms(2)35Ci-RA 952..1127 820..995 100   Plus
ms(2)35Ci-RA 78..896 1..819 99 <- Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:45:45 Download gff for AT28918.complete
Subject Subject Range Query Range Percent Splice Strand
2L 15292736..15292946 135..345 100 -> Plus
2L 15293009..15293147 346..484 100 -> Plus
2L 15292545..15292678 1..134 99 -> Plus
2L 15293209..15293537 485..813 100 -> Plus
2L 15293594..15293774 814..995 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:45:45 Download gff for AT28918.complete
Subject Subject Range Query Range Percent Splice Strand
2L 15292736..15292946 135..345 100 -> Plus
2L 15293009..15293147 346..484 100 -> Plus
2L 15292545..15292678 1..134 99 -> Plus
2L 15293209..15293537 485..813 100 -> Plus
2L 15293594..15293774 814..995 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:45:45 Download gff for AT28918.complete
Subject Subject Range Query Range Percent Splice Strand
2L 15292736..15292946 135..345 100 -> Plus
2L 15293009..15293147 346..484 100 -> Plus
2L 15292545..15292678 1..134 99 -> Plus
2L 15293209..15293537 485..813 100 -> Plus
2L 15293594..15293774 814..995 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:49:04 Download gff for AT28918.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 15293594..15293774 814..995 99   Plus
arm_2L 15292736..15292946 135..345 100 -> Plus
arm_2L 15293009..15293147 346..484 100 -> Plus
arm_2L 15293209..15293537 485..813 100 -> Plus
arm_2L 15292545..15292678 1..134 99 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:25:45 Download gff for AT28918.complete
Subject Subject Range Query Range Percent Splice Strand
2L 15292736..15292946 135..345 100 -> Plus
2L 15293009..15293147 346..484 100 -> Plus
2L 15293209..15293537 485..813 100 -> Plus
2L 15293594..15293774 814..995 99   Plus
2L 15292545..15292678 1..134 99 -> Plus

AT28918.pep Sequence

Translation from 135 to 536

> AT28918.pep
MPIIKKFCYCFSLRIGAFSIAYAGLTMDVLDTVATIYTKSQYCADILLLW
IISTIWNIISALVLLTALFRENPHLLPVHLVTSLCGLMLEMTNHMVIASL
GRTDYVLISYAFIMIAFVSADVVIVLSYYQSEV*

AT28918.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 01:44:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG25155-PA 133 GG25155-PA 1..133 1..133 553 76.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:16:10
Subject Length Description Subject Range Query Range Score Percent Strand
ms(2)35Ci-PC 133 CG31733-PC 1..133 1..133 673 100 Plus
ms(2)35Ci-PA 133 CG31733-PA 1..133 1..133 673 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 01:44:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26423-PA 135 GL26423-PA 1..131 1..131 182 31.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 01:44:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16431-PA 135 GA16431-PA 1..131 1..131 186 31.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 01:44:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16016-PA 133 GM16016-PA 1..133 1..133 674 97.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 01:44:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24002-PA 133 GD24002-PA 1..133 1..133 670 96.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 01:44:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17397-PA 128 GJ17397-PA 1..118 1..116 132 27.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 01:44:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20946-PA 133 GE20946-PA 1..133 1..133 529 80.5 Plus

AT28918.hyp Sequence

Translation from 135 to 536

> AT28918.hyp
MPIIKKFCYCFSLRIGAFSIAYAGLTMDVLDTVATIYTKSQYCADILLLW
IISTIWNIISALVLLTALFRENPHLLPVHLVTSLCGLMLEMTNHMVIASL
GRTDYVLISYAFIMIAFVSADVVIVLSYYQSEV*

AT28918.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:22:22
Subject Length Description Subject Range Query Range Score Percent Strand
ms(2)35Ci-PC 133 CG31733-PC 1..133 1..133 673 100 Plus
ms(2)35Ci-PA 133 CG31733-PA 1..133 1..133 673 100 Plus