AT28918.complete Sequence
1015 bp (1015 high quality bases) assembled on 2002-04-21
GenBank Submission: AY113326
> AT28918.complete
GGAAAGTCCGGCAATCCGCATAAATTCAAAGGAGTTCCTTCGAAAAATTG
TCAAATGTTGTAGGGTCCTCGGATACCTGGCAACAGAAATGGAGCTCGGA
AGAGACTTCATCAAAAGGACGTTAGAATTGTCACAATGCCAATAATCAAG
AAGTTCTGCTATTGTTTTAGTCTAAGAATTGGCGCATTTTCAATTGCGTA
CGCAGGTCTTACAATGGATGTATTAGATACAGTAGCGACTATATATACTA
AGTCGCAATATTGCGCTGATATACTACTCCTCTGGATAATTTCCACCATT
TGGAATATCATTTCCGCATTGGTTCTTTTGACTGCACTTTTTCGGGAAAA
TCCGCATTTGCTGCCAGTTCATCTGGTGACTTCTCTTTGTGGCCTGATGC
TCGAAATGACCAATCACATGGTGATTGCCTCCCTTGGCAGAACCGATTAC
GTTTTGATATCCTATGCGTTCATTATGATTGCCTTTGTATCTGCGGACGT
CGTGATCGTGCTGAGCTACTACCAATCGGAGGTTTAGTGAACCACTCCGA
TTACCCATTAACCCAGGCAACCGACCGGGCGCAGCATGTAGCATTTTGTG
GTGCGCGATTAGGCGCGAAAATTTATTTGGAAAATGTTGCGCAATCCGCG
CCGTGCATAAATCGTGGCCAATTGTCACCAGCGGATTGGCAACCGAACCT
CAGCGACCTGCGTTTAATTATCGCCCCGCCAGCGCCCGCCGAGCTACATG
CGTGCTAATTGACCAGGCTGCAGCTCAACGCTGCTCCAATCCGAAATCCG
AATACGAATCCGACTCCAAATGTCCAAATGATAACCGCGACGATGAAAAC
GCATGCTGAGCCAAATGAAAATTATGTTGCAATGGGGCAGGCGTGCTGCT
CGCTGGCTGGTCAGTGAACCGCAGTTTGCACCACCATCCATCCATGGGGC
TTAATTAATTTCCTTGATTAATTGAAAGTGCGCCTTGCTCGCAGTAAAAA
AAAAAAAAAAAAAAA
AT28918.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 19:14:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
ms(2)35Ci-RA | 1171 | ms(2)35Ci-RA | 78..894 | 1..817 | 4070 | 99.8 | Plus |
ms(2)35Ci.a | 1489 | ms(2)35Ci.a | 78..894 | 1..817 | 4070 | 99.8 | Plus |
ms(2)35Ci-RA | 1171 | ms(2)35Ci-RA | 947..1128 | 815..996 | 910 | 100 | Plus |
ms(2)35Ci.a | 1489 | ms(2)35Ci.a | 947..1128 | 815..996 | 910 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-15 12:44:34
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2L | 23010047 | chr2L | 15291991..15292323 | 485..817 | 1665 | 100 | Plus |
chr2L | 23010047 | chr2L | 15291514..15291729 | 131..346 | 1065 | 99.5 | Plus |
chr2L | 23010047 | chr2L | 15292376..15292556 | 815..995 | 905 | 100 | Plus |
chr2L | 23010047 | chr2L | 15291785..15291929 | 340..484 | 710 | 99.3 | Plus |
chr2L | 23010047 | chr2L | 15291327..15291460 | 1..134 | 670 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:01:48 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 12:44:32
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 15293209..15293541 | 485..817 | 1665 | 100 | Plus |
2L | 23513712 | 2L | 15292732..15292947 | 131..346 | 1065 | 99.5 | Plus |
2L | 23513712 | 2L | 15293594..15293775 | 815..996 | 910 | 100 | Plus |
2L | 23513712 | 2L | 15293003..15293147 | 340..484 | 710 | 99.3 | Plus |
2L | 23513712 | 2L | 15292545..15292678 | 1..134 | 655 | 99.3 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:44:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 15293209..15293541 | 485..817 | 1665 | 100 | Plus |
2L | 23513712 | 2L | 15292732..15292947 | 131..346 | 1065 | 99.5 | Plus |
2L | 23513712 | 2L | 15293594..15293775 | 815..996 | 910 | 100 | Plus |
2L | 23513712 | 2L | 15293003..15293147 | 340..484 | 710 | 99.3 | Plus |
2L | 23513712 | 2L | 15292545..15292678 | 1..134 | 655 | 99.2 | Plus |
Blast to na_te.dros performed on 2019-03-15 12:44:33 has no hits.
AT28918.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 12:45:45 Download gff for
AT28918.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2L | 15291327..15291460 | 1..134 | 100 | -> | Plus |
chr2L | 15291518..15291728 | 135..345 | 100 | -> | Plus |
chr2L | 15291791..15291929 | 346..484 | 100 | -> | Plus |
chr2L | 15291991..15292325 | 485..819 | 99 | -> | Plus |
chr2L | 15292381..15292556 | 820..995 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:28:40 Download gff for
AT28918.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
ms(2)35Ci-RB | 1..627 | 136..758 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:00:17 Download gff for
AT28918.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
ms(2)35Ci-RA | 1..402 | 136..537 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:49:04 Download gff for
AT28918.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
ms(2)35Ci-RA | 1..402 | 136..537 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:53:33 Download gff for
AT28918.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
ms(2)35Ci-RB | 1..627 | 136..758 | 99 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:08:32 Download gff for
AT28918.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
ms(2)35Ci-RA | 1..402 | 136..537 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:41:16 Download gff for
AT28918.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
ms(2)35Ci-RB | 1..823 | 1..819 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:00:17 Download gff for
AT28918.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
ms(2)35Ci-RA | 1..819 | 1..819 | 99 | <- | Plus |
ms(2)35Ci-RA | 875..1050 | 820..995 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:49:04 Download gff for
AT28918.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
ms(2)35Ci-RA | 78..896 | 1..819 | 99 | <- | Plus |
ms(2)35Ci-RA | 952..1127 | 820..995 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:53:33 Download gff for
AT28918.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
ms(2)35Ci-RB | 1..823 | 1..819 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:08:32 Download gff for
AT28918.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
ms(2)35Ci-RA | 952..1127 | 820..995 | 100 | | Plus |
ms(2)35Ci-RA | 78..896 | 1..819 | 99 | <- | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:45:45 Download gff for
AT28918.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 15292736..15292946 | 135..345 | 100 | -> | Plus |
2L | 15293009..15293147 | 346..484 | 100 | -> | Plus |
2L | 15292545..15292678 | 1..134 | 99 | -> | Plus |
2L | 15293209..15293537 | 485..813 | 100 | -> | Plus |
2L | 15293594..15293774 | 814..995 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:45:45 Download gff for
AT28918.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 15292736..15292946 | 135..345 | 100 | -> | Plus |
2L | 15293009..15293147 | 346..484 | 100 | -> | Plus |
2L | 15292545..15292678 | 1..134 | 99 | -> | Plus |
2L | 15293209..15293537 | 485..813 | 100 | -> | Plus |
2L | 15293594..15293774 | 814..995 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:45:45 Download gff for
AT28918.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 15292736..15292946 | 135..345 | 100 | -> | Plus |
2L | 15293009..15293147 | 346..484 | 100 | -> | Plus |
2L | 15292545..15292678 | 1..134 | 99 | -> | Plus |
2L | 15293209..15293537 | 485..813 | 100 | -> | Plus |
2L | 15293594..15293774 | 814..995 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:49:04 Download gff for
AT28918.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 15293594..15293774 | 814..995 | 99 | | Plus |
arm_2L | 15292736..15292946 | 135..345 | 100 | -> | Plus |
arm_2L | 15293009..15293147 | 346..484 | 100 | -> | Plus |
arm_2L | 15293209..15293537 | 485..813 | 100 | -> | Plus |
arm_2L | 15292545..15292678 | 1..134 | 99 | -> | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:25:45 Download gff for
AT28918.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 15292736..15292946 | 135..345 | 100 | -> | Plus |
2L | 15293009..15293147 | 346..484 | 100 | -> | Plus |
2L | 15293209..15293537 | 485..813 | 100 | -> | Plus |
2L | 15293594..15293774 | 814..995 | 99 | | Plus |
2L | 15292545..15292678 | 1..134 | 99 | -> | Plus |
AT28918.pep Sequence
Translation from 135 to 536
> AT28918.pep
MPIIKKFCYCFSLRIGAFSIAYAGLTMDVLDTVATIYTKSQYCADILLLW
IISTIWNIISALVLLTALFRENPHLLPVHLVTSLCGLMLEMTNHMVIASL
GRTDYVLISYAFIMIAFVSADVVIVLSYYQSEV*
AT28918.pep Blast Records
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 01:44:16
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG25155-PA | 133 | GG25155-PA | 1..133 | 1..133 | 553 | 76.7 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:16:10
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
ms(2)35Ci-PC | 133 | CG31733-PC | 1..133 | 1..133 | 673 | 100 | Plus |
ms(2)35Ci-PA | 133 | CG31733-PA | 1..133 | 1..133 | 673 | 100 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 01:44:18
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL26423-PA | 135 | GL26423-PA | 1..131 | 1..131 | 182 | 31.3 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 01:44:18
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA16431-PA | 135 | GA16431-PA | 1..131 | 1..131 | 186 | 31.3 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 01:44:19
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM16016-PA | 133 | GM16016-PA | 1..133 | 1..133 | 674 | 97.7 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 01:44:20
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD24002-PA | 133 | GD24002-PA | 1..133 | 1..133 | 670 | 96.2 | Plus |
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 01:44:20
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dvir\GJ17397-PA | 128 | GJ17397-PA | 1..118 | 1..116 | 132 | 27.5 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 01:44:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE20946-PA | 133 | GE20946-PA | 1..133 | 1..133 | 529 | 80.5 | Plus |
AT28918.hyp Sequence
Translation from 135 to 536
> AT28918.hyp
MPIIKKFCYCFSLRIGAFSIAYAGLTMDVLDTVATIYTKSQYCADILLLW
IISTIWNIISALVLLTALFRENPHLLPVHLVTSLCGLMLEMTNHMVIASL
GRTDYVLISYAFIMIAFVSADVVIVLSYYQSEV*
AT28918.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:22:22
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
ms(2)35Ci-PC | 133 | CG31733-PC | 1..133 | 1..133 | 673 | 100 | Plus |
ms(2)35Ci-PA | 133 | CG31733-PA | 1..133 | 1..133 | 673 | 100 | Plus |