Clone AT29239 Report

Search the DGRC for AT29239

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:292
Well:39
Vector:pOTB7
Associated Gene/TranscriptmRpL47-RB
Protein status:AT29239.pep: gold
Preliminary Size:623
Sequenced Size:1124

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9378 2002-01-01 Sim4 clustering to Release 2
CG9378 2002-01-11 Blastp of sequenced clone
CG9378 2003-01-01 Sim4 clustering to Release 3
Rlc1 2008-04-29 Release 5.5 accounting
Rlc1 2008-08-15 Release 5.9 accounting
Rlc1 2008-12-18 5.12 accounting

Clone Sequence Records

AT29239.complete Sequence

1124 bp (1124 high quality bases) assembled on 2002-01-11

GenBank Submission: AY089479

> AT29239.complete
GTAAACTTCAGTCGATTTGAAGCGAAAAATTCGATTTTTCATTAGCACTG
AGCGAAGCGCAACTAGAGCTGGCCAACAAGTCGATGCTGAAATTATACTA
TCGACTAATTTCAGTTGAAATGCATGGCAGCCCTGAAATGGAGTAAAGCC
CGGCTAAAAATGTAGTACGCACGCAATCCAATAAATCGATACAAAAAAGT
ATCGATTGTTATTGCTTCAGCTGTTTTGTTCGGTCGAAAAAATGTCTTCG
GCGTTAATAAAATGTTTAAATTTGGCAAAAACTGTGGGAAATGCGACAGT
CAGGAGCTTTTTGGCAGCTCCCAAGCAGCCATGGCAGTCGTGCAGTGCGG
CTGCCCTGCAAACGCCGCATGTTCAAATGCCGATGCAAATGCACACTTCC
GCTGTTCGCCGGGATCTTATGGAGTTCTTCGACGACAAGAAGAACTGGAG
CGAGAATGAGGTGAAGGTGGGCCGCGCCTGGCGGACGGAGGAGCTGCGTA
TCAAGTCCAACAAGGAGCTGCACCAGCTGTGGTTCGTGCTCCTCAAGGAG
CGCAACATGCTGCTGACCATGGAGCACGAGTGCAATGACAAAATGGAAGT
CTTCCCTAGTCCGGAGCGCATCGATAAGGTGAAAATCTCCATGGAAAACC
TGGAGACAGTAGTGAGGGAGCGGAACAAGGCGTATCACCTGCTGGAAACA
GGTGAAACGGGTGAACGGCCCCAGAAGGCGGTGAAGAACGCATTTGGCCT
GCAGGTCTCATACAAAGCATGCGAACACGCCCTGCCGCCCTTCATGAACC
TCAAATGGATTAAATCCCGCAACATTGGCTACGGCGGCAGAGCTGTGAAC
AGATTCCTCTTAAAGTACAGGGAGAAACTCTACAATGCCAAGCGCAAGGC
CAAGAACCGCTCCCGCAACGAAGTCATGATGATCCTGCGTCGCAACCCCA
ATTTCGATCTGGATGTGCTGCGTCGCCAGTTCCCCGATGTCAACGTGGAC
AAGCTGCGCAACGAGGACAAGATTCGTGGTCACTATGTGCCCAAAGTTGG
CGTGTGAGCAGCAAAGCTGCAGTTATTTAGTTATTAAAACAACAAAATAC
CATTAAAAAAAAAAAAAAAAAAAA

AT29239.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:30:05
Subject Length Description Subject Range Query Range Score Percent Strand
Rlc1-RB 1110 Rlc1-RB 1..1104 1..1104 5520 100 Plus
Rlc1.a 1150 Rlc1.a 1..906 1..906 4530 100 Plus
Rlc1-RA 1150 Rlc1-RA 1..906 1..906 4530 100 Plus
Rlc1.a 1150 Rlc1.a 960..1150 907..1097 955 100 Plus
Rlc1-RA 1150 Rlc1-RA 960..1150 907..1097 955 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 05:49:44
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 5341591..5341935 345..1 1725 100 Minus
chr3R 27901430 chr3R 5341228..5341514 630..344 1435 100 Minus
chr3R 27901430 chr3R 5340901..5341180 906..627 1400 100 Minus
chr3R 27901430 chr3R 5340650..5340847 1104..907 990 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:02:02 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 05:49:42
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 9515763..9516107 345..1 1725 100 Minus
3R 32079331 3R 9515399..9515686 631..344 1440 100 Minus
3R 32079331 3R 9515073..9515352 906..627 1400 100 Minus
3R 32079331 3R 9514822..9515019 1104..907 990 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:58:33
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 9256594..9256938 345..1 1725 100 Minus
3R 31820162 3R 9256230..9256517 631..344 1440 100 Minus
3R 31820162 3R 9255904..9256183 906..627 1400 100 Minus
3R 31820162 3R 9255653..9255850 1104..907 990 100 Minus
Blast to na_te.dros performed on 2019-03-16 05:49:42 has no hits.

AT29239.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 05:50:38 Download gff for AT29239.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 5340901..5341178 629..906 100 <- Minus
chr3R 5340650..5340847 907..1104 100 <- Minus
chr3R 5341230..5341512 346..628 100 <- Minus
chr3R 5341591..5341935 1..345 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:29:23 Download gff for AT29239.complete
Subject Subject Range Query Range Percent Splice Strand
Rlc1-RB 1..816 242..1057 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:48:32 Download gff for AT29239.complete
Subject Subject Range Query Range Percent Splice Strand
Rlc1-RB 1..816 242..1057 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:43:20 Download gff for AT29239.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL47-RB 1..816 242..1057 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:15:55 Download gff for AT29239.complete
Subject Subject Range Query Range Percent Splice Strand
Rlc1-RB 1..816 242..1057 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:08:44 Download gff for AT29239.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL47-RB 1..816 242..1057 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:12:32 Download gff for AT29239.complete
Subject Subject Range Query Range Percent Splice Strand
Rlc1-RB 1..1104 1..1104 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:48:32 Download gff for AT29239.complete
Subject Subject Range Query Range Percent Splice Strand
Rlc1-RB 1..1104 1..1104 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:43:20 Download gff for AT29239.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL47-RB 1..905 200..1104 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:15:55 Download gff for AT29239.complete
Subject Subject Range Query Range Percent Splice Strand
Rlc1-RB 1..1104 1..1104 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:08:44 Download gff for AT29239.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL47-RB 1..905 200..1104 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:50:38 Download gff for AT29239.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9514822..9515019 907..1104 100 <- Minus
3R 9515073..9515350 629..906 100 <- Minus
3R 9515402..9515684 346..628 100 <- Minus
3R 9515763..9516107 1..345 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:50:38 Download gff for AT29239.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9514822..9515019 907..1104 100 <- Minus
3R 9515073..9515350 629..906 100 <- Minus
3R 9515402..9515684 346..628 100 <- Minus
3R 9515763..9516107 1..345 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:50:38 Download gff for AT29239.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9514822..9515019 907..1104 100 <- Minus
3R 9515073..9515350 629..906 100 <- Minus
3R 9515402..9515684 346..628 100 <- Minus
3R 9515763..9516107 1..345 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:43:20 Download gff for AT29239.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 5340544..5340741 907..1104 100 <- Minus
arm_3R 5340795..5341072 629..906 100 <- Minus
arm_3R 5341124..5341406 346..628 100 <- Minus
arm_3R 5341485..5341829 1..345 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:49:49 Download gff for AT29239.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9255904..9256181 629..906 100 <- Minus
3R 9256233..9256515 346..628 100 <- Minus
3R 9256594..9256938 1..345 100   Minus
3R 9255653..9255850 907..1104 100 <- Minus

AT29239.pep Sequence

Translation from 241 to 1056

> AT29239.pep
MSSALIKCLNLAKTVGNATVRSFLAAPKQPWQSCSAAALQTPHVQMPMQM
HTSAVRRDLMEFFDDKKNWSENEVKVGRAWRTEELRIKSNKELHQLWFVL
LKERNMLLTMEHECNDKMEVFPSPERIDKVKISMENLETVVRERNKAYHL
LETGETGERPQKAVKNAFGLQVSYKACEHALPPFMNLKWIKSRNIGYGGR
AVNRFLLKYREKLYNAKRKAKNRSRNEVMMILRRNPNFDLDVLRRQFPDV
NVDKLRNEDKIRGHYVPKVGV*

AT29239.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 01:36:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16056-PA 267 GF16056-PA 1..265 1..269 1236 84.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 01:36:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17365-PA 272 GG17365-PA 1..272 1..271 1385 95.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 01:36:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19393-PA 273 GH19393-PA 1..271 1..269 1046 70.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:06:39
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL47-PB 271 CG9378-PB 1..271 1..271 1422 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 01:36:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22598-PA 270 GI22598-PA 1..268 1..269 1083 74.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 01:37:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22226-PA 268 GL22226-PA 1..268 1..271 1222 83 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 01:37:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA27426-PA 268 GA27426-PA 1..268 1..271 1215 82.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 01:37:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26250-PA 271 GM26250-PA 1..271 1..271 1444 98.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 01:37:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20790-PA 271 GD20790-PA 1..271 1..271 1424 97 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 01:37:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10316-PA 270 GJ10316-PA 1..268 1..269 1086 75.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 01:37:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13453-PA 268 GK13453-PA 1..268 1..271 1085 74.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 01:37:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24770-PA 278 GE24770-PA 1..278 1..271 1397 94.2 Plus

AT29239.hyp Sequence

Translation from 241 to 1056

> AT29239.hyp
MSSALIKCLNLAKTVGNATVRSFLAAPKQPWQSCSAAALQTPHVQMPMQM
HTSAVRRDLMEFFDDKKNWSENEVKVGRAWRTEELRIKSNKELHQLWFVL
LKERNMLLTMEHECNDKMEVFPSPERIDKVKISMENLETVVRERNKAYHL
LETGETGERPQKAVKNAFGLQVSYKACEHALPPFMNLKWIKSRNIGYGGR
AVNRFLLKYREKLYNAKRKAKNRSRNEVMMILRRNPNFDLDVLRRQFPDV
NVDKLRNEDKIRGHYVPKVGV*

AT29239.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:22:56
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL47-PB 271 CG9378-PB 1..271 1..271 1422 100 Plus