Clone AT29272 Report

Search the DGRC for AT29272

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:292
Well:72
Vector:pOTB7
Associated Gene/TranscriptCG31924-RB
Protein status:AT29272.pep: gold
Preliminary Size:699
Sequenced Size:837

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5564 2002-01-01 Sim4 clustering to Release 2
CG31924 2002-04-21 Blastp of sequenced clone
CG31924 2008-04-29 Release 5.5 accounting
CG31924 2008-08-15 Release 5.9 accounting
CG31924 2008-12-18 5.12 accounting

Clone Sequence Records

AT29272.complete Sequence

837 bp (837 high quality bases) assembled on 2002-04-21

GenBank Submission: AY113328

> AT29272.complete
AAATAATTCAAAATTCAAGTGAACCAAAATGTCGGCGGAAGAGGCGGGTT
CTAGGCAGTGCTCTTTTCAGCCAGTTACCCATTGCATTTTCGAACTCGAT
GGTCTGCTGATAGACAGCGAGCGTTTGAGAACGGAAACCGTTCAAAGGAT
TCTGGATCCCTATGGTCACACGTATAGCTTCGATCTGAAGATGCGGTGCA
TGGGAAAGCCAGATTCCGAGCAGGCTGCTCTAATCGTAAACACCTTCAAT
CTGCCCTTCAGCATGACGGAGTTTGAGAACCAGCAGGAACTTCAGTGTCG
TGGCAAAATGGGATTCATTCGACTGATGCCCGGTGTGGAGCGTCTGCTGC
ATCACCTCAAAGCGTTCAACATTCCCATGGCTATCGCAAGTGGCTGCTGT
CGGGATTCGTTTAGGATAAAGACGCGTCGGCACTCCAGGCCCTTCGATGT
CTTCCACCACGTGGTTTTGAGCGGCTCCGACGAAGAAGTCAAGAGGGGGA
AACCCGCTCCGGATGTTTTCCTCACCACCGCCTCTCGTTTTGAGGAATCG
CCGGAGCCGAGCAAGTGTCTGGTCTTCGAGTCCTCTTTGGTTGGTATGGA
GGCTGCTCTGTCCGCTGGCATGCAGGTGGTCCTCGTGCCCGATCCTCTGG
TATCCTTTCGAGCAAGTGCTCACGCCACTTTGAGACTGCGATCGCTGGAA
GGATTCAAGCCACAATATTTTGGACTGCCACCTTTGTGAGATATATGTAT
CATGTAGTTTGAAATCAAATGTTACACCATGTCAATAAATACAAATATAG
GAACCATTGTTTCTAGTGTAAAAAAAAAAAAAAAAAA

AT29272.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:14:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG31924-RB 819 CG31924-RB 1..819 1..819 4095 100 Plus
CG31924-RA 759 CG31924-RA 58..759 118..819 3510 100 Plus
CG31924-RA 759 CG31924-RA 1..57 1..57 285 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:26:52
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 1353960..1354769 819..10 3960 99.3 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:02:06 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:26:51
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 1354098..1354919 822..1 4110 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:44:28
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 1354098..1354919 822..1 4110 100 Minus
Blast to na_te.dros performed on 2019-03-16 07:26:51 has no hits.

AT29272.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:27:42 Download gff for AT29272.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 1353960..1354779 1..819 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:29:30 Download gff for AT29272.complete
Subject Subject Range Query Range Percent Splice Strand
CG31924-RB 1..711 29..739 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:00:18 Download gff for AT29272.complete
Subject Subject Range Query Range Percent Splice Strand
CG31924-RB 1..711 29..739 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:31:08 Download gff for AT29272.complete
Subject Subject Range Query Range Percent Splice Strand
CG31924-RB 1..711 29..739 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:53:34 Download gff for AT29272.complete
Subject Subject Range Query Range Percent Splice Strand
CG31924-RB 1..711 29..739 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:32:35 Download gff for AT29272.complete
Subject Subject Range Query Range Percent Splice Strand
CG31924-RB 1..711 29..739 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:41:18 Download gff for AT29272.complete
Subject Subject Range Query Range Percent Splice Strand
CG31924-RB 1..819 1..819 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:00:18 Download gff for AT29272.complete
Subject Subject Range Query Range Percent Splice Strand
CG31924-RB 1..819 1..819 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:31:08 Download gff for AT29272.complete
Subject Subject Range Query Range Percent Splice Strand
CG31924-RB 1..819 1..819 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:53:34 Download gff for AT29272.complete
Subject Subject Range Query Range Percent Splice Strand
CG31924-RB 1..819 1..819 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:32:35 Download gff for AT29272.complete
Subject Subject Range Query Range Percent Splice Strand
CG31924-RB 1..819 1..819 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:27:42 Download gff for AT29272.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1354101..1354919 1..819 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:27:42 Download gff for AT29272.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1354101..1354919 1..819 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:27:42 Download gff for AT29272.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1354101..1354919 1..819 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:31:08 Download gff for AT29272.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 1354101..1354919 1..819 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:25:47 Download gff for AT29272.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1354101..1354919 1..819 100   Minus

AT29272.pep Sequence

Translation from 28 to 738

> AT29272.pep
MSAEEAGSRQCSFQPVTHCIFELDGLLIDSERLRTETVQRILDPYGHTYS
FDLKMRCMGKPDSEQAALIVNTFNLPFSMTEFENQQELQCRGKMGFIRLM
PGVERLLHHLKAFNIPMAIASGCCRDSFRIKTRRHSRPFDVFHHVVLSGS
DEEVKRGKPAPDVFLTTASRFEESPEPSKCLVFESSLVGMEAALSAGMQV
VLVPDPLVSFRASAHATLRLRSLEGFKPQYFGLPPL*

AT29272.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 01:44:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19687-PA 241 GF19687-PA 11..241 7..236 951 78.4 Plus
Dana\GF14724-PA 240 GF14724-PA 7..229 13..234 426 41.5 Plus
Dana\GF24022-PA 304 GF24022-PA 92..302 26..236 424 40.8 Plus
Dana\GF14725-PA 240 GF14725-PA 7..229 13..234 423 40.2 Plus
Dana\GF14726-PA 141 GF14726-PA 1..130 106..234 262 43.5 Plus
Dana\GF24022-PA 304 GF24022-PA 9..99 16..106 219 45.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 01:44:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24597-PA 240 GG24597-PA 7..240 3..236 1097 88.9 Plus
Dere\GG24373-PA 304 GG24373-PA 70..300 1..234 432 39.3 Plus
Dere\GG24596-PA 153 GG24596-PA 1..144 94..236 289 40.7 Plus
Dere\GG24600-PA 297 GG24600-PA 22..244 11..235 250 28.4 Plus
Dere\GG24373-PA 304 GG24373-PA 9..103 16..110 198 40 Plus
Dere\GG24599-PA 241 GG24599-PA 4..233 6..224 173 24.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 01:44:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10332-PA 238 GH10332-PA 7..228 13..235 517 46.2 Plus
Dgri\GH11658-PA 304 GH11658-PA 70..302 1..236 443 40.3 Plus
Dgri\GH11411-PA 303 GH11411-PA 34..245 19..233 257 31.5 Plus
Dgri\GH11658-PA 304 GH11658-PA 3..103 10..110 219 40.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:24:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG31924-PB 236 CG31924-PB 1..236 1..236 1231 100 Plus
Gs1l-PA 231 CG15441-PA 9..227 16..234 532 48.9 Plus
Gs1l-PB 231 CG15441-PB 9..227 16..234 486 43.4 Plus
CG5565-PA 240 CG5565-PA 3..230 8..235 424 41.3 Plus
CG5556-PB 299 CG5556-PB 22..244 11..235 233 28.9 Plus
CG5556-PA 299 CG5556-PA 22..244 11..235 233 28.9 Plus
CG5561-PA 305 CG5561-PA 16..244 5..235 205 25.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 01:44:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17090-PA 240 GI17090-PA 2..229 6..234 479 41.6 Plus
Dmoj\GI17960-PA 304 GI17960-PA 92..302 26..236 450 43.6 Plus
Dmoj\GI18114-PA 299 GI18114-PA 38..253 16..234 235 29.2 Plus
Dmoj\GI17960-PA 304 GI17960-PA 3..103 10..110 229 41.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 01:44:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15659-PA 236 GL15659-PA 1..235 1..235 788 61.7 Plus
Dper\GL14869-PA 236 GL14869-PA 1..235 1..235 788 61.7 Plus
Dper\GL15658-PA 240 GL15658-PA 2..229 7..234 487 41.7 Plus
Dper\GL14859-PA 240 GL14859-PA 2..229 7..234 483 41.3 Plus
Dper\GL15404-PA 304 GL15404-PA 92..302 26..236 480 43.6 Plus
Dper\GL15404-PA 304 GL15404-PA 9..103 16..110 247 46.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 01:45:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA23996-PA 236 GA23996-PA 1..235 1..235 790 62.1 Plus
Dpse\GA16569-PA 236 GA16569-PA 1..235 1..235 790 62.1 Plus
Dpse\GA25364-PA 236 GA25364-PA 1..235 1..235 787 61.7 Plus
Dpse\GA25358-PA 240 GA25358-PA 2..229 7..234 483 41.3 Plus
Dpse\GA18974-PA 240 GA18974-PA 2..229 7..234 483 41.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 01:45:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16614-PA 216 GM16614-PA 1..216 1..236 1026 85.6 Plus
Dsec\GM16613-PA 240 GM16613-PA 3..231 8..236 442 42 Plus
Dsec\GM18089-PA 304 GM18089-PA 92..300 26..234 435 42.6 Plus
Dsec\GM16616-PA 299 GM16616-PA 22..244 11..235 236 28 Plus
Dsec\GM18089-PA 304 GM18089-PA 9..99 16..106 196 41.8 Plus
Dsec\GM16615-PA 304 GM16615-PA 16..245 5..236 195 24.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 01:45:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22913-PA 216 GD22913-PA 1..216 1..236 1028 85.6 Plus
Dsim\GD22912-PA 240 GD22912-PA 3..231 8..236 434 41.6 Plus
Dsim\GD22707-PA 304 GD22707-PA 92..300 26..234 427 41.6 Plus
Dsim\GD22707-PA 304 GD22707-PA 9..103 16..110 198 40 Plus
Dsim\GD22914-PA 274 GD22914-PA 5..219 7..235 168 25.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 01:45:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10810-PA 240 GJ10810-PA 5..229 8..234 591 49.8 Plus
Dvir\GJ17733-PA 304 GJ17733-PA 92..302 26..236 456 44.1 Plus
Dvir\GJ17047-PA 308 GJ17047-PA 38..252 16..233 246 30.7 Plus
Dvir\GJ17733-PA 304 GJ17733-PA 3..103 10..110 223 40.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 01:45:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19038-PA 243 GK19038-PA 9..240 5..236 744 59.5 Plus
Dwil\GK13331-PA 238 GK13331-PA 13..236 13..236 513 43.3 Plus
Dwil\GK15189-PA 240 GK15189-PA 7..229 13..234 493 43.8 Plus
Dwil\GK23925-PA 304 GK23925-PA 91..302 25..236 458 42.9 Plus
Dwil\GK14950-PA 294 GK14950-PA 15..243 7..235 239 30 Plus
Dwil\GK23925-PA 304 GK23925-PA 3..99 10..106 204 41.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 01:45:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15644-PA 240 GE15644-PA 7..240 3..236 1082 86.3 Plus
Dyak\GE15633-PA 240 GE15633-PA 4..229 9..234 436 42.1 Plus
Dyak\GE14717-PA 304 GE14717-PA 70..300 1..234 433 40.2 Plus
Dyak\GE15666-PA 301 GE15666-PA 22..244 11..235 265 29.8 Plus
Dyak\GE15655-PA 304 GE15655-PA 19..245 8..236 211 24.9 Plus
Dyak\GE14717-PA 304 GE14717-PA 9..103 16..110 197 40 Plus

AT29272.hyp Sequence

Translation from 28 to 738

> AT29272.hyp
MSAEEAGSRQCSFQPVTHCIFELDGLLIDSERLRTETVQRILDPYGHTYS
FDLKMRCMGKPDSEQAALIVNTFNLPFSMTEFENQQELQCRGKMGFIRLM
PGVERLLHHLKAFNIPMAIASGCCRDSFRIKTRRHSRPFDVFHHVVLSGS
DEEVKRGKPAPDVFLTTASRFEESPEPSKCLVFESSLVGMEAALSAGMQV
VLVPDPLVSFRASAHATLRLRSLEGFKPQYFGLPPL*

AT29272.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:23:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG31924-PB 236 CG31924-PB 1..236 1..236 1231 100 Plus
Gs1l-PA 231 CG15441-PA 9..227 16..234 532 48.9 Plus
Gs1l-PB 231 CG15441-PB 9..227 16..234 486 43.4 Plus
CG5565-PA 240 CG5565-PA 3..230 8..235 424 41.3 Plus
CG5556-PB 299 CG5556-PB 22..244 11..235 233 28.9 Plus