Clone AT29875 Report

Search the DGRC for AT29875

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:298
Well:75
Vector:pOTB7
Associated Gene/TranscriptRpL36-RA
Protein status:AT29875.pep: gold
Sequenced Size:557

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7622 2001-12-17 Blastp of sequenced clone
CG7622 2002-01-01 Sim4 clustering to Release 2
CG7622 2003-01-01 Sim4 clustering to Release 3
RpL36 2008-04-29 Release 5.5 accounting
RpL36 2008-08-15 Release 5.9 accounting
RpL36 2008-12-18 5.12 accounting

Clone Sequence Records

AT29875.complete Sequence

557 bp (557 high quality bases) assembled on 2001-12-17

GenBank Submission: AY070831

> AT29875.complete
CGACTATCGCCCATCTCCAACTGCCATACTGTTTCCTGTCCAACTTTTTT
CGCTCTTTCTTTCTTTTAACAGCGTCTGAGTTAAAATGGCAGTGCGCTAC
GAGCTGGCTATTGGCCTGAACAAGGGCCACAAGACCTCGAAGATCAGGAA
TGTGAAGTACACCGGCGACAAGAAGGTCAAGGGTCTGCGCGGATCGCGCT
TGAAGAACATCCAAACCCGCCACACCAAGTTCATGCGCGACTTGGTCCGC
GAGGTCGTTGGCCACGCTCCCTATGAGAAGCGCACCATGGAGTTGCTGAA
GGTGTCCAAGGATAAGAGGGCCCTGAAGTTCCTCAAGCGCCGCCTGGGCA
CCCACATCCGTGCCAAGAGGAAGCGTGAGGAGTTGTCCAACATCCTCACC
CAGCTGAGGAAGGCCCAGACCCACGCCAAGTAAACGGACGGAATCTGATT
CGACATCTCGGCATCGGAAGGCAACCTGGAGCGCCGTGTTATGTTCTCAT
TTCTTTCCGATGACGTTACTTGAGAATTAAACAACTAAAATTCGTTAAAA
AAAAAAA

AT29875.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:37:06
Subject Length Description Subject Range Query Range Score Percent Strand
RpL36-RA 704 RpL36-RA 29..585 1..557 2785 100 Plus
RpL36.c 874 RpL36.c 199..755 1..557 2785 100 Plus
RpL36-RB 928 RpL36-RB 333..809 81..557 2385 100 Plus
RpL36-RB 928 RpL36-RB 199..278 1..80 400 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:41:46
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 522334..522671 546..209 1690 100 Minus
chrX 22417052 chrX 522736..522865 208..79 650 100 Minus
chrX 22417052 chrX 523368..523447 80..1 400 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:02:25 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:41:45
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 628338..628686 557..209 1745 100 Minus
X 23542271 X 628751..628880 208..79 650 100 Minus
X 23542271 X 629382..629461 80..1 400 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:04:35
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 636436..636784 557..209 1745 100 Minus
X 23527363 X 636849..636978 208..79 650 100 Minus
X 23527363 X 637480..637559 80..1 400 100 Minus
Blast to na_te.dros performed on 2019-03-16 06:41:45 has no hits.

AT29875.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 06:42:35 Download gff for AT29875.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 522334..522671 209..546 100 <- Minus
chrX 522736..522863 81..208 100 <- Minus
chrX 523368..523447 1..80 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:30:00 Download gff for AT29875.complete
Subject Subject Range Query Range Percent Splice Strand
RpL36-RD 1..348 86..433 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:00:23 Download gff for AT29875.complete
Subject Subject Range Query Range Percent Splice Strand
RpL36-RD 1..348 86..433 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:27:45 Download gff for AT29875.complete
Subject Subject Range Query Range Percent Splice Strand
RpL36-RB 1..348 86..433 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:25:02 Download gff for AT29875.complete
Subject Subject Range Query Range Percent Splice Strand
RpL36-RD 1..348 86..433 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:22:45 Download gff for AT29875.complete
Subject Subject Range Query Range Percent Splice Strand
RpL36-RD 1..348 86..433 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:26:19 Download gff for AT29875.complete
Subject Subject Range Query Range Percent Splice Strand
RpL36-RA 2..547 1..546 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:00:23 Download gff for AT29875.complete
Subject Subject Range Query Range Percent Splice Strand
RpL36-RA 2..547 1..546 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:27:45 Download gff for AT29875.complete
Subject Subject Range Query Range Percent Splice Strand
RpL36-RA 2..547 1..546 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:25:02 Download gff for AT29875.complete
Subject Subject Range Query Range Percent Splice Strand
RpL36-RA 2..547 1..546 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:22:45 Download gff for AT29875.complete
Subject Subject Range Query Range Percent Splice Strand
RpL36-RA 23..568 1..546 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:42:35 Download gff for AT29875.complete
Subject Subject Range Query Range Percent Splice Strand
X 628349..628686 209..546 100 <- Minus
X 628751..628878 81..208 100 <- Minus
X 629382..629461 1..80 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:42:35 Download gff for AT29875.complete
Subject Subject Range Query Range Percent Splice Strand
X 628349..628686 209..546 100 <- Minus
X 628751..628878 81..208 100 <- Minus
X 629382..629461 1..80 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:42:35 Download gff for AT29875.complete
Subject Subject Range Query Range Percent Splice Strand
X 628349..628686 209..546 100 <- Minus
X 628751..628878 81..208 100 <- Minus
X 629382..629461 1..80 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:27:45 Download gff for AT29875.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 522382..522719 209..546 100 <- Minus
arm_X 522784..522911 81..208 100 <- Minus
arm_X 523415..523494 1..80 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:00:27 Download gff for AT29875.complete
Subject Subject Range Query Range Percent Splice Strand
X 636447..636784 209..546 100 <- Minus
X 636849..636976 81..208 100 <- Minus
X 637480..637559 1..80 100   Minus

AT29875.hyp Sequence

Translation from 85 to 432

> AT29875.hyp
MAVRYELAIGLNKGHKTSKIRNVKYTGDKKVKGLRGSRLKNIQTRHTKFM
RDLVREVVGHAPYEKRTMELLKVSKDKRALKFLKRRLGTHIRAKRKREEL
SNILTQLRKAQTHAK*

AT29875.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:24:00
Subject Length Description Subject Range Query Range Score Percent Strand
RpL36-PE 115 CG7622-PE 1..115 1..115 578 100 Plus
RpL36-PC 115 CG7622-PC 1..115 1..115 578 100 Plus
RpL36-PD 115 CG7622-PD 1..115 1..115 578 100 Plus
RpL36-PB 115 CG7622-PB 1..115 1..115 578 100 Plus
RpL36-PA 115 CG7622-PA 1..115 1..115 578 100 Plus

AT29875.pep Sequence

Translation from 85 to 432

> AT29875.pep
MAVRYELAIGLNKGHKTSKIRNVKYTGDKKVKGLRGSRLKNIQTRHTKFM
RDLVREVVGHAPYEKRTMELLKVSKDKRALKFLKRRLGTHIRAKRKREEL
SNILTQLRKAQTHAK*

AT29875.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:13:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21342-PA 115 GF21342-PA 1..115 1..115 569 96.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:13:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12751-PA 115 GG12751-PA 1..115 1..115 578 99.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:13:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24619-PA 115 GH24619-PA 1..115 1..115 554 93 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:24:00
Subject Length Description Subject Range Query Range Score Percent Strand
RpL36-PE 115 CG7622-PE 1..115 1..115 578 100 Plus
RpL36-PC 115 CG7622-PC 1..115 1..115 578 100 Plus
RpL36-PD 115 CG7622-PD 1..115 1..115 578 100 Plus
RpL36-PB 115 CG7622-PB 1..115 1..115 578 100 Plus
RpL36-PA 115 CG7622-PA 1..115 1..115 578 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:13:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11079-PA 115 GI11079-PA 1..115 1..115 556 93.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:13:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14685-PA 115 GL14685-PA 1..115 1..115 569 96.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:13:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20486-PA 115 GA20486-PA 1..115 1..115 569 96.5 Plus
Dpse\GA23124-PA 114 GA23124-PA 5..114 2..115 529 93 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:13:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19031-PA 115 GM19031-PA 1..115 1..115 581 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:13:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16468-PA 112 GD16468-PA 1..112 1..115 554 97.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:13:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14783-PA 115 GJ14783-PA 1..115 1..115 560 94.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:13:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25446-PA 115 GK25446-PA 1..115 1..115 567 95.7 Plus
Dwil\GK12645-PA 115 GK12645-PA 1..115 1..115 550 92.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:13:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\RpL36-PA 115 GE16576-PA 1..115 1..115 578 99.1 Plus