BDGP Sequence Production Resources |
Search the DGRC for AT29875
Library: | AT |
Tissue Source: | Drosophila melanogaster adult testes |
Created by: | Ling Hong |
Date Registered: | 2000-06-08 |
Comments: | Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7 |
Original Plate Number: | 298 |
Well: | 75 |
Vector: | pOTB7 |
Associated Gene/Transcript | RpL36-RA |
Protein status: | AT29875.pep: gold |
Sequenced Size: | 557 |
Gene | Date | Evidence |
---|---|---|
CG7622 | 2001-12-17 | Blastp of sequenced clone |
CG7622 | 2002-01-01 | Sim4 clustering to Release 2 |
CG7622 | 2003-01-01 | Sim4 clustering to Release 3 |
RpL36 | 2008-04-29 | Release 5.5 accounting |
RpL36 | 2008-08-15 | Release 5.9 accounting |
RpL36 | 2008-12-18 | 5.12 accounting |
557 bp (557 high quality bases) assembled on 2001-12-17
GenBank Submission: AY070831
> AT29875.complete CGACTATCGCCCATCTCCAACTGCCATACTGTTTCCTGTCCAACTTTTTT CGCTCTTTCTTTCTTTTAACAGCGTCTGAGTTAAAATGGCAGTGCGCTAC GAGCTGGCTATTGGCCTGAACAAGGGCCACAAGACCTCGAAGATCAGGAA TGTGAAGTACACCGGCGACAAGAAGGTCAAGGGTCTGCGCGGATCGCGCT TGAAGAACATCCAAACCCGCCACACCAAGTTCATGCGCGACTTGGTCCGC GAGGTCGTTGGCCACGCTCCCTATGAGAAGCGCACCATGGAGTTGCTGAA GGTGTCCAAGGATAAGAGGGCCCTGAAGTTCCTCAAGCGCCGCCTGGGCA CCCACATCCGTGCCAAGAGGAAGCGTGAGGAGTTGTCCAACATCCTCACC CAGCTGAGGAAGGCCCAGACCCACGCCAAGTAAACGGACGGAATCTGATT CGACATCTCGGCATCGGAAGGCAACCTGGAGCGCCGTGTTATGTTCTCAT TTCTTTCCGATGACGTTACTTGAGAATTAAACAACTAAAATTCGTTAAAA AAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
RpL36-RA | 704 | RpL36-RA | 29..585 | 1..557 | 2785 | 100 | Plus |
RpL36.c | 874 | RpL36.c | 199..755 | 1..557 | 2785 | 100 | Plus |
RpL36-RB | 928 | RpL36-RB | 333..809 | 81..557 | 2385 | 100 | Plus |
RpL36-RB | 928 | RpL36-RB | 199..278 | 1..80 | 400 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chrX | 22417052 | chrX | 522334..522671 | 546..209 | 1690 | 100 | Minus |
chrX | 22417052 | chrX | 522736..522865 | 208..79 | 650 | 100 | Minus |
chrX | 22417052 | chrX | 523368..523447 | 80..1 | 400 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chrX | 522334..522671 | 209..546 | 100 | <- | Minus |
chrX | 522736..522863 | 81..208 | 100 | <- | Minus |
chrX | 523368..523447 | 1..80 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL36-RD | 1..348 | 86..433 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL36-RD | 1..348 | 86..433 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL36-RB | 1..348 | 86..433 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL36-RD | 1..348 | 86..433 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL36-RD | 1..348 | 86..433 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL36-RA | 2..547 | 1..546 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL36-RA | 2..547 | 1..546 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL36-RA | 2..547 | 1..546 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL36-RA | 2..547 | 1..546 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL36-RA | 23..568 | 1..546 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 628349..628686 | 209..546 | 100 | <- | Minus |
X | 628751..628878 | 81..208 | 100 | <- | Minus |
X | 629382..629461 | 1..80 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 628349..628686 | 209..546 | 100 | <- | Minus |
X | 628751..628878 | 81..208 | 100 | <- | Minus |
X | 629382..629461 | 1..80 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 628349..628686 | 209..546 | 100 | <- | Minus |
X | 628751..628878 | 81..208 | 100 | <- | Minus |
X | 629382..629461 | 1..80 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_X | 522382..522719 | 209..546 | 100 | <- | Minus |
arm_X | 522784..522911 | 81..208 | 100 | <- | Minus |
arm_X | 523415..523494 | 1..80 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 636447..636784 | 209..546 | 100 | <- | Minus |
X | 636849..636976 | 81..208 | 100 | <- | Minus |
X | 637480..637559 | 1..80 | 100 | Minus |
Translation from 85 to 432
> AT29875.hyp MAVRYELAIGLNKGHKTSKIRNVKYTGDKKVKGLRGSRLKNIQTRHTKFM RDLVREVVGHAPYEKRTMELLKVSKDKRALKFLKRRLGTHIRAKRKREEL SNILTQLRKAQTHAK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
RpL36-PE | 115 | CG7622-PE | 1..115 | 1..115 | 578 | 100 | Plus |
RpL36-PC | 115 | CG7622-PC | 1..115 | 1..115 | 578 | 100 | Plus |
RpL36-PD | 115 | CG7622-PD | 1..115 | 1..115 | 578 | 100 | Plus |
RpL36-PB | 115 | CG7622-PB | 1..115 | 1..115 | 578 | 100 | Plus |
RpL36-PA | 115 | CG7622-PA | 1..115 | 1..115 | 578 | 100 | Plus |
Translation from 85 to 432
> AT29875.pep MAVRYELAIGLNKGHKTSKIRNVKYTGDKKVKGLRGSRLKNIQTRHTKFM RDLVREVVGHAPYEKRTMELLKVSKDKRALKFLKRRLGTHIRAKRKREEL SNILTQLRKAQTHAK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF21342-PA | 115 | GF21342-PA | 1..115 | 1..115 | 569 | 96.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG12751-PA | 115 | GG12751-PA | 1..115 | 1..115 | 578 | 99.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH24619-PA | 115 | GH24619-PA | 1..115 | 1..115 | 554 | 93 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
RpL36-PE | 115 | CG7622-PE | 1..115 | 1..115 | 578 | 100 | Plus |
RpL36-PC | 115 | CG7622-PC | 1..115 | 1..115 | 578 | 100 | Plus |
RpL36-PD | 115 | CG7622-PD | 1..115 | 1..115 | 578 | 100 | Plus |
RpL36-PB | 115 | CG7622-PB | 1..115 | 1..115 | 578 | 100 | Plus |
RpL36-PA | 115 | CG7622-PA | 1..115 | 1..115 | 578 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI11079-PA | 115 | GI11079-PA | 1..115 | 1..115 | 556 | 93.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL14685-PA | 115 | GL14685-PA | 1..115 | 1..115 | 569 | 96.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA20486-PA | 115 | GA20486-PA | 1..115 | 1..115 | 569 | 96.5 | Plus |
Dpse\GA23124-PA | 114 | GA23124-PA | 5..114 | 2..115 | 529 | 93 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM19031-PA | 115 | GM19031-PA | 1..115 | 1..115 | 581 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD16468-PA | 112 | GD16468-PA | 1..112 | 1..115 | 554 | 97.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ14783-PA | 115 | GJ14783-PA | 1..115 | 1..115 | 560 | 94.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK25446-PA | 115 | GK25446-PA | 1..115 | 1..115 | 567 | 95.7 | Plus |
Dwil\GK12645-PA | 115 | GK12645-PA | 1..115 | 1..115 | 550 | 92.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\RpL36-PA | 115 | GE16576-PA | 1..115 | 1..115 | 578 | 99.1 | Plus |