AT29956.complete Sequence
533 bp (533 high quality bases) assembled on 2001-12-16
GenBank Submission: AY070832
> AT29956.complete
CCTCGTGCCGCAACAAAATTAGCCGTCTTTTGCGGTTACCGAAATTAACG
CAAATGGGTATGAAACGCTTTGTATCCTCTTTGATTCGCAAGTCCCCGAT
CAGTCCGTCGGAGCCTGGAAAATTGGCTGCCGGTTGCCCAGCCGTGTTCG
CCCAAGACGGCACGTGGAGTGCCAAGTTCAATGGTCAGTTCGCTCCGGAG
AAGATTAACGATCAGGTGATCAAGCAAGAGTCCGGCCGCAAGGACGACGA
TTTAACTTCCACAATTCGACTCCCACGCAAACGTTCTTGGCTACAGAGGC
GTGTGATTCCCGTGTAGACGTCGCTTGCGTGGTTAAATATCCAAAAATGC
CAAATCTGTAATCGCAACTTCAGTCGCAGTTTTACAGTTTCACGCTGTGG
TGTGCAAAGTAAATGATTTATTACTTCAATTACTTGATTTTCTATGATTT
GCCGGGATTGTTATGAGCTATGTTTTAATAAATTTAAGTGATTAAACAAA
TTTTCGGAAAACCCAAAAAAAAAAAAAAAAAAA
AT29956.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 19:37:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG16741-RA | 561 | CG16741-RA | 56..556 | 14..516 | 2400 | 98.8 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 03:07:48
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2R | 21145070 | chr2R | 16234090..16234593 | 11..514 | 2490 | 99.6 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:02:30 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 03:07:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 20347091..20347591 | 14..516 | 2390 | 98.8 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:05:16
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25260384 | 2R | 20348290..20348790 | 14..516 | 2400 | 98.8 | Plus |
Blast to na_te.dros performed on 2019-03-16 03:07:46 has no hits.
AT29956.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 03:08:52 Download gff for
AT29956.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2R | 16234090..16234593 | 11..514 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:30:09 Download gff for
AT29956.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG16741-RA | 1..264 | 54..317 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:01:30 Download gff for
AT29956.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG16741-RA | 1..264 | 54..317 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:54:42 Download gff for
AT29956.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG16741-RA | 1..264 | 54..317 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:26:04 Download gff for
AT29956.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG16741-RA | 1..264 | 54..317 | 99 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:31:21 Download gff for
AT29956.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG16741-RA | 1..264 | 54..317 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:27:52 Download gff for
AT29956.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG16741-RA | 53..554 | 11..514 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:01:30 Download gff for
AT29956.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG16741-RA | 53..554 | 11..514 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:54:42 Download gff for
AT29956.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG16741-RA | 48..549 | 11..514 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:26:04 Download gff for
AT29956.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG16741-RA | 53..554 | 11..514 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:31:21 Download gff for
AT29956.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG16741-RA | 48..549 | 11..514 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:08:52 Download gff for
AT29956.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 20347088..20347589 | 11..514 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:08:52 Download gff for
AT29956.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 20347088..20347589 | 11..514 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:08:52 Download gff for
AT29956.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 20347088..20347589 | 11..514 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:54:42 Download gff for
AT29956.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 16234593..16235094 | 11..514 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:01:42 Download gff for
AT29956.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 20348287..20348788 | 11..514 | 98 | | Plus |
AT29956.hyp Sequence
Translation from 11 to 316
> AT29956.hyp
TKISRLLRLPKLTQMGMKRFVSSLIRKSPISPSEPGKLAAGCPAVFAQDG
TWSAKFNGQFAPEKINDQVIKQESGRKDDDLTSTIRLPRKRSWLQRRVIP
V*
AT29956.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:24:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG16741-PA | 87 | CG16741-PA | 1..87 | 15..101 | 451 | 100 | Plus |
AT29956.pep Sequence
Translation from 53 to 316
> AT29956.pep
MGMKRFVSSLIRKSPISPSEPGKLAAGCPAVFAQDGTWSAKFNGQFAPEK
INDQVIKQESGRKDDDLTSTIRLPRKRSWLQRRVIPV*
AT29956.pep Blast Records
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:56:24
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG22032-PA | 82 | GG22032-PA | 1..80 | 1..85 | 329 | 78.8 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:48:14
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG16741-PA | 87 | CG16741-PA | 1..87 | 1..87 | 451 | 100 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:56:25
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM22014-PA | 87 | GM22014-PA | 1..86 | 1..86 | 416 | 93 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:56:26
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD11513-PA | 87 | GD11513-PA | 1..86 | 1..86 | 416 | 93 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:56:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE12110-PA | 90 | GE12110-PA | 1..89 | 1..86 | 353 | 80.9 | Plus |