Clone AT29956 Report

Search the DGRC for AT29956

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:299
Well:56
Vector:pOTB7
Associated Gene/TranscriptCG16741-RA
Protein status:AT29956.pep: gold
Preliminary Size:553
Sequenced Size:533

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG16741 2001-12-16 Blastp of sequenced clone
CG16741 2002-01-01 Sim4 clustering to Release 2
CG16741 2003-01-01 Sim4 clustering to Release 3
CG16741 2008-04-29 Release 5.5 accounting
CG16741 2008-08-15 Release 5.9 accounting
CG16741 2008-12-18 5.12 accounting

Clone Sequence Records

AT29956.complete Sequence

533 bp (533 high quality bases) assembled on 2001-12-16

GenBank Submission: AY070832

> AT29956.complete
CCTCGTGCCGCAACAAAATTAGCCGTCTTTTGCGGTTACCGAAATTAACG
CAAATGGGTATGAAACGCTTTGTATCCTCTTTGATTCGCAAGTCCCCGAT
CAGTCCGTCGGAGCCTGGAAAATTGGCTGCCGGTTGCCCAGCCGTGTTCG
CCCAAGACGGCACGTGGAGTGCCAAGTTCAATGGTCAGTTCGCTCCGGAG
AAGATTAACGATCAGGTGATCAAGCAAGAGTCCGGCCGCAAGGACGACGA
TTTAACTTCCACAATTCGACTCCCACGCAAACGTTCTTGGCTACAGAGGC
GTGTGATTCCCGTGTAGACGTCGCTTGCGTGGTTAAATATCCAAAAATGC
CAAATCTGTAATCGCAACTTCAGTCGCAGTTTTACAGTTTCACGCTGTGG
TGTGCAAAGTAAATGATTTATTACTTCAATTACTTGATTTTCTATGATTT
GCCGGGATTGTTATGAGCTATGTTTTAATAAATTTAAGTGATTAAACAAA
TTTTCGGAAAACCCAAAAAAAAAAAAAAAAAAA

AT29956.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:37:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG16741-RA 561 CG16741-RA 56..556 14..516 2400 98.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 03:07:48
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 16234090..16234593 11..514 2490 99.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:02:30 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 03:07:45
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 20347091..20347591 14..516 2390 98.8 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:05:16
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 20348290..20348790 14..516 2400 98.8 Plus
Blast to na_te.dros performed on 2019-03-16 03:07:46 has no hits.

AT29956.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 03:08:52 Download gff for AT29956.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 16234090..16234593 11..514 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:30:09 Download gff for AT29956.complete
Subject Subject Range Query Range Percent Splice Strand
CG16741-RA 1..264 54..317 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:01:30 Download gff for AT29956.complete
Subject Subject Range Query Range Percent Splice Strand
CG16741-RA 1..264 54..317 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:54:42 Download gff for AT29956.complete
Subject Subject Range Query Range Percent Splice Strand
CG16741-RA 1..264 54..317 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:26:04 Download gff for AT29956.complete
Subject Subject Range Query Range Percent Splice Strand
CG16741-RA 1..264 54..317 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:31:21 Download gff for AT29956.complete
Subject Subject Range Query Range Percent Splice Strand
CG16741-RA 1..264 54..317 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:27:52 Download gff for AT29956.complete
Subject Subject Range Query Range Percent Splice Strand
CG16741-RA 53..554 11..514 98   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:01:30 Download gff for AT29956.complete
Subject Subject Range Query Range Percent Splice Strand
CG16741-RA 53..554 11..514 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:54:42 Download gff for AT29956.complete
Subject Subject Range Query Range Percent Splice Strand
CG16741-RA 48..549 11..514 98   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:26:04 Download gff for AT29956.complete
Subject Subject Range Query Range Percent Splice Strand
CG16741-RA 53..554 11..514 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:31:21 Download gff for AT29956.complete
Subject Subject Range Query Range Percent Splice Strand
CG16741-RA 48..549 11..514 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:08:52 Download gff for AT29956.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20347088..20347589 11..514 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:08:52 Download gff for AT29956.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20347088..20347589 11..514 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:08:52 Download gff for AT29956.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20347088..20347589 11..514 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:54:42 Download gff for AT29956.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 16234593..16235094 11..514 98   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:01:42 Download gff for AT29956.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20348287..20348788 11..514 98   Plus

AT29956.hyp Sequence

Translation from 11 to 316

> AT29956.hyp
TKISRLLRLPKLTQMGMKRFVSSLIRKSPISPSEPGKLAAGCPAVFAQDG
TWSAKFNGQFAPEKINDQVIKQESGRKDDDLTSTIRLPRKRSWLQRRVIP
V*

AT29956.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:24:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG16741-PA 87 CG16741-PA 1..87 15..101 451 100 Plus

AT29956.pep Sequence

Translation from 53 to 316

> AT29956.pep
MGMKRFVSSLIRKSPISPSEPGKLAAGCPAVFAQDGTWSAKFNGQFAPEK
INDQVIKQESGRKDDDLTSTIRLPRKRSWLQRRVIPV*

AT29956.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:56:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22032-PA 82 GG22032-PA 1..80 1..85 329 78.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:48:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG16741-PA 87 CG16741-PA 1..87 1..87 451 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:56:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22014-PA 87 GM22014-PA 1..86 1..86 416 93 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:56:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11513-PA 87 GD11513-PA 1..86 1..86 416 93 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:56:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12110-PA 90 GE12110-PA 1..89 1..86 353 80.9 Plus