Clone AT30011 Report

Search the DGRC for AT30011

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:300
Well:11
Vector:pOTB7
Associated Gene/TranscriptCG7164-RA
Protein status:AT30011.pep: gold
Preliminary Size:978
Sequenced Size:1010

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7164 2002-01-01 Sim4 clustering to Release 2
CG7164 2002-01-18 Blastp of sequenced clone
CG7164 2003-01-01 Sim4 clustering to Release 3
CG7164 2008-04-29 Release 5.5 accounting
CG7164 2008-08-15 Release 5.9 accounting
CG7164 2008-12-18 5.12 accounting

Clone Sequence Records

AT30011.complete Sequence

1010 bp (1010 high quality bases) assembled on 2002-01-18

GenBank Submission: AY089482

> AT30011.complete
AATCCTAAAATGAGGCATCGTTCCTAAAAAAATATATATAAAATAAATTC
CACAATTTTCGACCACTTTGGCAGTCAAAATTCGCAATCTAAATTCGAAA
TTAGCAAATAACCATTTAGCCACAAACAACGTGACCATGACCAATCGACT
GGCCTTGCACCACATCCTGACCACCCAGCTGCGAAGGGACTGGGAACAGG
AGGAGAGCGCCAAGACCAGGCTGTCGCAGCTGTCCAGGAGGGACAGGATC
AAGGCCTCGCTAAGATCGAGTCAGTTGCCAGGACGTTACCTGTTGCCCGA
CACCAGAAAGACCTACGACAATATGGTGGCCAATATTCACTCGACCATGA
AGTCGGTACGAGCACCACGAAGACCACGGCCAACGGGGCCGCTGCCCACA
TCTGGAACTCCGAATCCAGTACCAGTAGTTGCACCACCACTGCCATCGAA
ACTGGTGTCCAAGCAACCGCAACGCAAGTCGGCGGGGCGCATCAAGGGTG
GCGGCAACTCTTCGAAAGCGGACAGTGGCCATGGCATTGCCATCAAATCA
TTGGCGAAGGTCAAGGCCTGCATCAACCAGAAGCAGAAGAGATCGCGGGG
CTTTGAGCAGCACAATCGCATCCGTGAAGTCATCCAACAGAAGAAAGTGC
TGGAGACCATGTTGCAGCAGCACAAGAAGCTGCAAAGCGATCGACACACC
ATAGCGATGGATATCCAGCGAATGCGTGCCGATCTGGACAGGATTCGCAA
CAAGCTGGACACCTCGCTGCAGAGCCTCAACTCGACGCGCACCCTATTCA
GTGCCGCCAACAAGGCGAGTCTCAGGAAGTCGACCGCCCTGCAGAAGCCC
ACGCAAAACATGGTGACCTCCACCAATCGCCGCTCGGGTGGCAAACGAAA
GGCCCGGACCGTTGCCATTCCGATGAACCGGCAAAGTGTGCTGACCAACA
AGGCCCCTATTCTCAAACGAAAAGTTCGGTGAAATGCAAAGTAAAAAAAA
AAAAAAAAAA

AT30011.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:28:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG7164-RA 1211 CG7164-RA 59..1068 1..1010 4915 99.1 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 03:09:45
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 7780996..7781634 354..992 3150 99.5 Plus
chr2L 23010047 chr2L 7780583..7780935 1..353 1735 99.4 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:02:34 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 03:09:43
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 7781912..7782568 354..1010 3195 99.1 Plus
2L 23513712 2L 7781499..7781851 1..353 1720 99.2 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:57:15
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 7781912..7782568 354..1010 3195 99 Plus
2L 23513712 2L 7781499..7781851 1..353 1720 99.1 Plus
Blast to na_te.dros performed on 2019-03-16 03:09:43 has no hits.

AT30011.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 03:10:47 Download gff for AT30011.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 7780583..7780935 1..353 92 -> Plus
chr2L 7780996..7781634 354..992 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:30:15 Download gff for AT30011.complete
Subject Subject Range Query Range Percent Splice Strand
CG7164-RA 1..846 137..982 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:45:14 Download gff for AT30011.complete
Subject Subject Range Query Range Percent Splice Strand
CG7164-RA 1..846 137..982 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:55:15 Download gff for AT30011.complete
Subject Subject Range Query Range Percent Splice Strand
CG7164-RA 1..846 137..982 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:13:36 Download gff for AT30011.complete
Subject Subject Range Query Range Percent Splice Strand
CG7164-RA 1..846 137..982 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:32:46 Download gff for AT30011.complete
Subject Subject Range Query Range Percent Splice Strand
CG7164-RA 1..846 137..982 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:09:41 Download gff for AT30011.complete
Subject Subject Range Query Range Percent Splice Strand
CG7164-RA 1..988 5..992 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:45:13 Download gff for AT30011.complete
Subject Subject Range Query Range Percent Splice Strand
CG7164-RA 1..988 5..992 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:55:15 Download gff for AT30011.complete
Subject Subject Range Query Range Percent Splice Strand
CG7164-RA 35..1026 1..992 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:13:36 Download gff for AT30011.complete
Subject Subject Range Query Range Percent Splice Strand
CG7164-RA 1..988 5..992 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:32:46 Download gff for AT30011.complete
Subject Subject Range Query Range Percent Splice Strand
CG7164-RA 35..1026 1..992 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:10:47 Download gff for AT30011.complete
Subject Subject Range Query Range Percent Splice Strand
2L 7781499..7781851 1..353 99 -> Plus
2L 7781912..7782550 354..992 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:10:47 Download gff for AT30011.complete
Subject Subject Range Query Range Percent Splice Strand
2L 7781499..7781851 1..353 99 -> Plus
2L 7781912..7782550 354..992 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:10:47 Download gff for AT30011.complete
Subject Subject Range Query Range Percent Splice Strand
2L 7781499..7781851 1..353 99 -> Plus
2L 7781912..7782550 354..992 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:55:15 Download gff for AT30011.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 7781499..7781851 1..353 99 -> Plus
arm_2L 7781912..7782550 354..992 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:47:36 Download gff for AT30011.complete
Subject Subject Range Query Range Percent Splice Strand
2L 7781499..7781851 1..353 99 -> Plus
2L 7781912..7782550 354..992 99   Plus

AT30011.pep Sequence

Translation from 136 to 981

> AT30011.pep
MTNRLALHHILTTQLRRDWEQEESAKTRLSQLSRRDRIKASLRSSQLPGR
YLLPDTRKTYDNMVANIHSTMKSVRAPRRPRPTGPLPTSGTPNPVPVVAP
PLPSKLVSKQPQRKSAGRIKGGGNSSKADSGHGIAIKSLAKVKACINQKQ
KRSRGFEQHNRIREVIQQKKVLETMLQQHKKLQSDRHTIAMDIQRMRADL
DRIRNKLDTSLQSLNSTRTLFSAANKASLRKSTALQKPTQNMVTSTNRRS
GGKRKARTVAIPMNRQSVLTNKAPILKRKVR*

AT30011.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:53:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21776-PA 284 GF21776-PA 2..282 3..279 494 48.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:53:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10495-PA 280 GG10495-PA 1..280 1..281 1145 79.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:53:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13676-PA 270 GH13676-PA 1..221 1..227 247 36.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:49:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG7164-PB 281 CG7164-PB 1..281 1..281 1412 100 Plus
CG7164-PA 281 CG7164-PA 1..281 1..281 1412 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:53:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17103-PA 275 GI17103-PA 52..274 55..281 318 40.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:53:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19285-PA 328 GL19285-PA 1..257 1..227 300 36.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:53:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20148-PA 328 GA20148-PA 1..257 1..227 300 36.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:53:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16563-PA 277 GM16563-PA 1..277 1..281 1310 91.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:53:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23487-PA 281 GD23487-PA 1..281 1..281 1348 92.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:53:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16142-PA 279 GJ16142-PA 1..257 1..260 312 36.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:53:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24640-PA 302 GK24640-PA 1..244 1..240 410 42.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:53:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14618-PA 286 GE14618-PA 1..286 1..281 1157 83.9 Plus

AT30011.hyp Sequence

Translation from 136 to 981

> AT30011.hyp
MTNRLALHHILTTQLRRDWEQEESAKTRLSQLSRRDRIKASLRSSQLPGR
YLLPDTRKTYDNMVANIHSTMKSVRAPRRPRPTGPLPTSGTPNPVPVVAP
PLPSKLVSKQPQRKSAGRIKGGGNSSKADSGHGIAIKSLAKVKACINQKQ
KRSRGFEQHNRIREVIQQKKVLETMLQQHKKLQSDRHTIAMDIQRMRADL
DRIRNKLDTSLQSLNSTRTLFSAANKASLRKSTALQKPTQNMVTSTNRRS
GGKRKARTVAIPMNRQSVLTNKAPILKRKVR*

AT30011.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:24:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG7164-PB 281 CG7164-PB 1..281 1..281 1412 100 Plus
CG7164-PA 281 CG7164-PA 1..281 1..281 1412 100 Plus