Clone AT30033 Report

Search the DGRC for AT30033

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:300
Well:33
Vector:pOTB7
Associated Gene/TranscriptProsbeta4R1-RA
Protein status:AT30033.pep: gold
Preliminary Size:647
Sequenced Size:784

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17301 2002-01-01 Sim4 clustering to Release 2
CG17301 2003-01-01 Sim4 clustering to Release 3
CG17301 2003-01-22 Blastp of sequenced clone
CG17301 2008-04-29 Release 5.5 accounting
CG17301 2008-08-15 Release 5.9 accounting
CG17301 2008-12-18 5.12 accounting

Clone Sequence Records

AT30033.complete Sequence

784 bp (784 high quality bases) assembled on 2003-01-22

GenBank Submission: AY075275

> AT30033.complete
CCGACTAAAATTTACTGAATCAAACATTACCTAAAATGGAAACCATTTTG
GGTGTTAAAGGAACTGATTTCATCATACTGGCCTCGGATACCATGAGGAA
CAAGTCGGCGATGTGGCTGGATGACGAGGTCAGAAAGACTCACCGCATCT
CGGACTACTGCATGATGTCGACCGCTGGGGACGGTGGAGACTGCCTGAAG
TTCTCGGATTTCATCCTCCGGAACATGGATCTTTACAAGATAACCAACGG
ATACGACTTAACCGTTCGCGGAGCGGTGCACTTCATCCGGAGGCATTTGT
CCGCCTATTTGAAGAGCGATTGCACGTTCCAGGTGTCGCTGTTGGTGGGC
GGATACGATTTGACCAGCGGTCCCGAGTTGCACTACATCGATTATTTGGG
TAACTCGGTTCCCGTTCGGTACGGTGGCCACGGAGCCGCCATGAACTTCT
GCACTCCCATTCTCGAGGAGTTCTACAAACCGGACATGGATACGCAGGCA
GCCTATGATGTTATCAAAAAGTGTGTGATTGAGCTGTATAAACGATTCGT
TATCAACTTGCGCAACATAGATTTGTTCCTGATAAGCAAAAATGGCATAA
CAAAGATGAATAGCATCAACCTGGAGTCCCTTAGAGGGGATATCTTAGCT
GGTCCCAAGCGAAGGATATTAAACACAAAATAATAATCGAAGCCCTTTAT
ATTTTTTGTAGCTTATCAAAGATTCATAAAATTTGAATCAAAAATAATTG
AATATAAAGCTCTGTAAAAAAAAAAAAAAAAAAA

AT30033.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:12:35
Subject Length Description Subject Range Query Range Score Percent Strand
Prosbeta4R1-RA 839 Prosbeta4R1-RA 46..810 1..766 3760 99.6 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 17:08:33
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 2653057..2653696 126..765 3140 99.4 Plus
chr2L 23010047 chr2L 2652881..2653006 1..126 630 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:02:38 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 17:08:31
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2653288..2653927 126..766 3125 99.5 Plus
2L 23513712 2L 2653112..2653237 1..126 630 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:55:01
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2653288..2653927 126..766 3135 99.5 Plus
2L 23513712 2L 2653112..2653237 1..126 630 100 Plus
Blast to na_te.dros performed 2019-03-15 17:08:31
Subject Length Description Subject Range Query Range Score Percent Strand
mdg1 7480 mdg1 DMRTMGD1 7480bp Derived from X59545 (g8507) (Rel. 49, Last updated, Version 4). 1487..1579 666..758 122 61.7 Plus

AT30033.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 17:09:42 Download gff for AT30033.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 2652881..2653006 1..126 100 -> Plus
chr2L 2653058..2653696 127..765 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:30:20 Download gff for AT30033.complete
Subject Subject Range Query Range Percent Splice Strand
CG17301-RA 1..648 36..683 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:44:17 Download gff for AT30033.complete
Subject Subject Range Query Range Percent Splice Strand
Prosbeta4R1-RA 1..648 36..683 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:27:29 Download gff for AT30033.complete
Subject Subject Range Query Range Percent Splice Strand
Prosbeta4R1-RA 1..648 36..683 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:34:03 Download gff for AT30033.complete
Subject Subject Range Query Range Percent Splice Strand
CG17301-RA 1..648 36..683 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:26:28 Download gff for AT30033.complete
Subject Subject Range Query Range Percent Splice Strand
Prosbeta4R1-RA 1..648 36..683 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:54:48 Download gff for AT30033.complete
Subject Subject Range Query Range Percent Splice Strand
CG17301-RA 1..764 1..765 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:44:17 Download gff for AT30033.complete
Subject Subject Range Query Range Percent Splice Strand
Prosbeta4R1-RA 1..764 1..765 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:27:29 Download gff for AT30033.complete
Subject Subject Range Query Range Percent Splice Strand
Prosbeta4R1-RA 67..830 1..765 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:34:03 Download gff for AT30033.complete
Subject Subject Range Query Range Percent Splice Strand
CG17301-RA 1..764 1..765 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:26:28 Download gff for AT30033.complete
Subject Subject Range Query Range Percent Splice Strand
Prosbeta4R1-RA 67..830 1..765 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:09:42 Download gff for AT30033.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2653112..2653237 1..126 100 -> Plus
2L 2653289..2653926 127..765 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:09:42 Download gff for AT30033.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2653112..2653237 1..126 100 -> Plus
2L 2653289..2653926 127..765 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:09:42 Download gff for AT30033.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2653112..2653237 1..126 100 -> Plus
2L 2653289..2653926 127..765 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:27:29 Download gff for AT30033.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 2653112..2653237 1..126 100 -> Plus
arm_2L 2653289..2653926 127..765 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:05:44 Download gff for AT30033.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2653289..2653926 127..765 99   Plus
2L 2653112..2653237 1..126 100 -> Plus

AT30033.hyp Sequence

Translation from 35 to 682

> AT30033.hyp
METILGVKGTDFIILASDTMRNKSAMWLDDEVRKTHRISDYCMMSTAGDG
GDCLKFSDFILRNMDLYKITNGYDLTVRGAVHFIRRHLSAYLKSDCTFQV
SLLVGGYDLTSGPELHYIDYLGNSVPVRYGGHGAAMNFCTPILEEFYKPD
MDTQAAYDVIKKCVIELYKRFVINLRNIDLFLISKNGITKMNSINLESLR
GDILAGPKRRILNTK*

AT30033.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:24:19
Subject Length Description Subject Range Query Range Score Percent Strand
Prosbeta4R1-PA 215 CG17301-PA 1..215 1..215 1128 100 Plus
Prosbeta4R2-PB 210 CG17302-PB 3..207 1..205 525 43.9 Plus
Prosbeta4R2-PA 210 CG17302-PA 3..207 1..205 525 43.9 Plus
Prosbeta4-PB 201 CG17331-PB 1..199 1..199 489 43.2 Plus
Prosbeta4-PA 201 CG17331-PA 1..199 1..199 489 43.2 Plus

AT30033.pep Sequence

Translation from 35 to 682

> AT30033.pep
METILGVKGTDFIILASDTMRNKSAMWLDDEVRKTHRISDYCMMSTAGDG
GDCLKFSDFILRNMDLYKITNGYDLTVRGAVHFIRRHLSAYLKSDCTFQV
SLLVGGYDLTSGPELHYIDYLGNSVPVRYGGHGAAMNFCTPILEEFYKPD
MDTQAAYDVIKKCVIELYKRFVINLRNIDLFLISKNGITKMNSINLESLR
GDILAGPKRRILNTK*

AT30033.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:41:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20768-PA 212 GF20768-PA 1..210 1..211 563 46.4 Plus
Dana\GF13881-PA 210 GF13881-PA 3..201 1..199 554 46.2 Plus
Dana\GF24340-PA 205 GF24340-PA 1..205 1..205 496 42.4 Plus
Dana\GF21212-PA 322 GF21212-PA 52..250 3..205 148 22.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:41:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24868-PA 215 GG24868-PA 1..215 1..215 924 79.1 Plus
Dere\GG24870-PA 210 GG24870-PA 3..207 1..205 540 44.4 Plus
Dere\GG20111-PA 201 GG20111-PA 1..199 1..199 502 42.2 Plus
Dere\GG18789-PA 307 GG18789-PA 50..245 3..202 167 23.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:41:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11159-PA 222 GH11159-PA 1..204 1..204 556 44.1 Plus
Dgri\GH22171-PA 222 GH22171-PA 1..204 1..204 556 44.1 Plus
Dgri\GH11559-PA 206 GH11559-PA 1..199 1..199 506 42.7 Plus
Dgri\GH11158-PA 397 GH11158-PA 1..118 44..161 202 36.4 Plus
Dgri\GH12772-PA 300 GH12772-PA 46..244 3..205 166 23.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:55:49
Subject Length Description Subject Range Query Range Score Percent Strand
Prosbeta4R1-PA 215 CG17301-PA 1..215 1..215 1128 100 Plus
Prosbeta4R2-PB 210 CG17302-PB 3..207 1..205 525 43.9 Plus
Prosbeta4R2-PA 210 CG17302-PA 3..207 1..205 525 43.9 Plus
Prosbeta4-PB 201 CG17331-PB 1..199 1..199 489 43.2 Plus
Prosbeta4-PA 201 CG17331-PA 1..199 1..199 489 43.2 Plus
Prosbeta2R1-PA 307 CG18341-PA 50..247 3..204 161 24.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:41:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17870-PA 221 GI17870-PA 1..204 1..204 546 44.1 Plus
Dmoj\GI17050-PA 206 GI17050-PA 1..199 1..199 487 40.7 Plus
Dmoj\GI17867-PA 214 GI17867-PA 1..192 1..192 369 36.5 Plus
Dmoj\GI15360-PA 313 GI15360-PA 46..241 3..202 161 23 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:41:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26572-PA 210 GL26572-PA 3..207 1..205 544 45.4 Plus
Dper\GL19338-PA 214 GL19338-PA 1..207 1..199 457 40.1 Plus
Dper\GL27233-PA 208 GL27233-PA 1..201 1..200 429 37.8 Plus
Dper\GL24711-PA 272 GL24711-PA 42..236 4..202 150 22.6 Plus
Dper\GL21838-PA 312 GL21838-PA 51..200 3..156 149 24 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:41:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28985-PA 210 GA28985-PA 3..207 1..205 544 45.4 Plus
Dpse\GA14463-PA 206 GA14463-PA 1..199 1..199 503 42.7 Plus
Dpse\GA26779-PA 208 GA26779-PA 1..201 1..200 429 37.8 Plus
Dpse\GA26418-PA 312 GA26418-PA 51..200 3..156 156 24.7 Plus
Dpse\GA17382-PA 272 GA17382-PA 42..236 4..202 149 22.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:41:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18352-PA 211 GM18352-PA 1..211 1..211 970 84.4 Plus
Dsec\GM18354-PA 210 GM18354-PA 3..207 1..205 536 43.4 Plus
Dsec\GM17161-PA 201 GM17161-PA 1..199 1..199 503 42.2 Plus
Dsec\GM12440-PA 307 GM12440-PA 50..248 3..205 170 24.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:41:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23166-PA 211 GD23166-PA 1..211 1..211 959 82.9 Plus
Dsim\GD23168-PA 210 GD23168-PA 3..207 1..205 536 43.4 Plus
Dsim\GD21900-PA 201 GD21900-PA 1..199 1..199 506 42.2 Plus
Dsim\GD16756-PA 307 GD16756-PA 50..248 3..205 170 24.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:41:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17300-PA 206 GJ17300-PA 1..199 1..199 501 41.7 Plus
Dvir\GJ17367-PA 231 GJ17367-PA 1..191 1..191 472 44.5 Plus
Dvir\GJ17369-PA 193 GJ17369-PA 6..176 34..204 460 43.9 Plus
Dvir\GJ16628-PA 304 GJ16628-PA 46..243 3..204 151 23.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:41:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24489-PA 210 GK24489-PA 3..201 1..199 568 48.7 Plus
Dwil\GK15122-PA 207 GK15122-PA 1..206 1..206 512 43.7 Plus
Dwil\GK24488-PA 212 GK24488-PA 7..203 2..198 404 36.5 Plus
Dwil\GK10550-PA 272 GK10550-PA 41..236 3..202 145 22.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:42:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18166-PA 215 GE18166-PA 1..215 1..215 952 80.9 Plus
Dyak\GE18168-PA 210 GE18168-PA 3..207 1..205 532 43.4 Plus
Dyak\GE13168-PA 201 GE13168-PA 1..199 1..199 502 42.2 Plus
Dyak\GE16434-PA 315 GE16434-PA 50..248 3..205 170 23.6 Plus