Clone AT30094 Report

Search the DGRC for AT30094

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:300
Well:94
Vector:pOTB7
Associated Gene/TranscriptCG31717-RA
Protein status:AT30094.pep: gold
Sequenced Size:808

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4926 2002-01-01 Sim4 clustering to Release 2
CG31717 2003-01-01 Sim4 clustering to Release 3
CG31717 2003-01-22 Blastp of sequenced clone
CG31717 2008-04-29 Release 5.5 accounting
CG31717 2008-08-15 Release 5.9 accounting
CG31717 2008-12-18 5.12 accounting

Clone Sequence Records

AT30094.complete Sequence

808 bp (808 high quality bases) assembled on 2003-01-22

GenBank Submission: AY075278

> AT30094.complete
CGAGTATACATCGAATGACGAATGAGAAATACTGTCATCACTAACAATAA
ATAAAAACAAAAGAGTTGAAATACACAGCGATATGAGGACGTCATCACCA
GCACTTAAATACCTATTGGAGAAGGATGTTCAGGTGTCGAAGCATTTCGT
AGTAGCCGTCTCCAATCTGTCGTTCTTCAAATCCCTGCGGATCCACAGCA
GATTTCTGGAGATATCATGCGATGGAATCGCCTGGTTTGTCTCATGGATC
GCCTTCATCTGGTTGCTCAGCTCAAAGAGCTTGTATCAAATGCAAGTCAA
TATGCTCTTCGGCCTGATACTCGACGTGGTGATCGTGGCCGTGCTGAAGG
CGCTGGTTCGTCGCAGGCGACCCGTGGCCAGCAAGGATATGCTGACCATT
GGACCCGATAAGTTCAGCTTTCCCTCAGGTCATGCCTCCCGGGCGTTCTT
TGTGCTCCTGTTCTTCGCCAAGCTGTACCCGCTCCACATCATATTCCTAA
TGCCGGTCACAGCTTGGGCTGTAAGCGTGGCCATCTCACGGCTCATCCTC
CAGCGTCATTATATTTTGGATATCTGCGCCGGTGCTGCCATCGGAGTGTT
GGAGGCACTAATCGTGGGACTTCTGTGGATCAGCGAGGAAACTGCATTTA
GCATTGTGGGCTTTGTTACCGAGGAAACTGTCGACAGCATGGAGTAACGA
TAAGTTACGATTGGAACACCGAAAGCAATAGATAATCTCTAGATCATTAT
GATGAATGCTTTAACCAAATACATTGTTAATGTTAAATTCAAAAAAAAAA
AAAAAAAA

AT30094.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:24:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG31717-RA 968 CG31717-RA 48..838 1..791 3820 98.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 11:59:22
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 10249751..10250450 91..790 3425 99.3 Plus
chr2L 23010047 chr2L 10249593..10249683 1..91 455 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:02:42 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 11:59:20
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10250895..10251595 91..791 3370 98.7 Plus
2L 23513712 2L 10250737..10250827 1..91 455 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:02:23
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10250895..10251595 91..791 3370 98.7 Plus
2L 23513712 2L 10250737..10250827 1..91 455 100 Plus
Blast to na_te.dros performed 2019-03-15 11:59:20
Subject Length Description Subject Range Query Range Score Percent Strand
Ivk 5402 Ivk IVK 5402bp 1538..1599 5..67 114 66.7 Plus
17.6 7439 17.6 DMIS176 7439bp AKA(J01060,J01061) Derived from X01472 (g8142) (Rel. 36, Last updated, Version 2). 918..968 22..72 111 68.6 Plus

AT30094.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 12:00:26 Download gff for AT30094.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 10249593..10249683 1..91 100 -> Plus
chr2L 10249752..10250450 92..790 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:30:27 Download gff for AT30094.complete
Subject Subject Range Query Range Percent Splice Strand
CG31717-RA 1..615 83..697 98   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:55:13 Download gff for AT30094.complete
Subject Subject Range Query Range Percent Splice Strand
CG31717-RA 1..615 83..697 98   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:35:23 Download gff for AT30094.complete
Subject Subject Range Query Range Percent Splice Strand
CG31717-RA 1..615 83..697 98   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:46:14 Download gff for AT30094.complete
Subject Subject Range Query Range Percent Splice Strand
CG31717-RA 1..615 83..697 98   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:47:30 Download gff for AT30094.complete
Subject Subject Range Query Range Percent Splice Strand
CG31717-RA 1..615 83..697 98   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:10:27 Download gff for AT30094.complete
Subject Subject Range Query Range Percent Splice Strand
CG31717-RA 1..790 1..790 98   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:55:13 Download gff for AT30094.complete
Subject Subject Range Query Range Percent Splice Strand
CG31717-RA 1..790 1..790 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:35:23 Download gff for AT30094.complete
Subject Subject Range Query Range Percent Splice Strand
CG31717-RA 1..790 1..790 98   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:46:15 Download gff for AT30094.complete
Subject Subject Range Query Range Percent Splice Strand
CG31717-RA 1..790 1..790 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:47:30 Download gff for AT30094.complete
Subject Subject Range Query Range Percent Splice Strand
CG31717-RA 1..790 1..790 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:00:26 Download gff for AT30094.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10250737..10250827 1..91 100 -> Plus
2L 10250896..10251594 92..790 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:00:26 Download gff for AT30094.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10250737..10250827 1..91 100 -> Plus
2L 10250896..10251594 92..790 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:00:26 Download gff for AT30094.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10250737..10250827 1..91 100 -> Plus
2L 10250896..10251594 92..790 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:35:23 Download gff for AT30094.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 10250737..10250827 1..91 100 -> Plus
arm_2L 10250896..10251594 92..790 98   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:17:19 Download gff for AT30094.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10250896..10251594 92..790 98   Plus
2L 10250737..10250827 1..91 100 -> Plus

AT30094.hyp Sequence

Translation from 82 to 696

> AT30094.hyp
MRTSSPALKYLLEKDVQVSKHFVVAVSNLSFFKSLRIHSRFLEISCDGIA
WFVSWIAFIWLLSSKSLYQMQVNMLFGLILDVVIVAVLKALVRRRRPVAS
KDMLTIGPDKFSFPSGHASRAFFVLLFFAKLYPLHIIFLMPVTAWAVSVA
ISRLILQRHYILDICAGAAIGVLEALIVGLLWISEETAFSIVGFVTEETV
DSME*

AT30094.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:24:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG31717-PB 204 CG31717-PB 1..204 1..204 1020 100 Plus
CG31717-PA 204 CG31717-PA 1..204 1..204 1020 100 Plus

AT30094.pep Sequence

Translation from 82 to 696

> AT30094.pep
MRTSSPALKYLLEKDVQVSKHFVVAVSNLSFFKSLRIHSRFLEISCDGIA
WFVSWIAFIWLLSSKSLYQMQVNMLFGLILDVVIVAVLKALVRRRRPVAS
KDMLTIGPDKFSFPSGHASRAFFVLLFFAKLYPLHIIFLMPVTAWAVSVA
ISRLILQRHYILDICAGAAIGVLEALIVGLLWISEETAFSIVGFVTEETV
DSME*

AT30094.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:26:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15755-PA 205 GF15755-PA 1..202 1..202 960 89.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:26:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10096-PA 204 GG10096-PA 1..204 1..204 964 94.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 08:26:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13360-PA 207 GH13360-PA 1..202 1..200 679 61.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:03:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG31717-PB 204 CG31717-PB 1..204 1..204 1020 100 Plus
CG31717-PA 204 CG31717-PA 1..204 1..204 1020 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 08:26:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17619-PA 200 GI17619-PA 3..197 4..198 663 65.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 08:26:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19163-PA 198 GL19163-PA 1..193 4..196 702 68.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 08:26:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16419-PA 198 GA16419-PA 1..193 4..196 709 69.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:26:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18048-PA 204 GM18048-PA 1..204 1..204 1041 98.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:26:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23668-PA 204 GD23668-PA 1..204 1..204 1042 99 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 08:26:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18120-PA 197 GJ18120-PA 1..197 5..201 675 60.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 08:26:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19233-PA 202 GK19233-PA 2..197 5..200 648 58.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:26:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18910-PA 204 GE18910-PA 1..204 1..204 966 94.6 Plus