AT30190.complete Sequence
527 bp (527 high quality bases) assembled on 2003-01-22
GenBank Submission: AY075279
> AT30190.complete
AATACAACATGAGTGAGTCCGCATCTGAGGACACAGATTCTGAAGGGGTT
GCTGCCGTGCCAGTTCCCGATACCACGCCTCGCGATGCGGACGCCACAAC
TTCCGGAGCCCGGATGATGATGCAACACCCATGGTTGACGGCAGCCGGAG
TTGCCGTCTATGCCACCAGAGTCATTTGGGTCAAGTTGCGTGTGCTCCGG
TTGGCCAAACAGTTGCGCCTCCAGAAGCAAAGATTTTGGAAGTCTAATCC
CTGGCAGGACAATGAATCTGGCTCTGAGGCAGAGAGTGATACCGATGGCG
AGGAAGGCGATTCTGACGAGTCTACAGATACAGATGTGAATCGTAATAGA
ATTGAAGCTACTGATAATGATCGGTTAGTCCGAGTGCCGCAATAGTTTTT
CAAGATGTTTTTCGAATTTAAATTCAATGCTGCAAGTTATTAACATTGTT
AGCTGGATTAGAGGGTACCATATGCTTTAAAATACAAATCGTTTCTCATA
TTCAATTTTAAAAAAAAAAAAAAAAAA
AT30190.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 20:44:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG18469-RA | 509 | CG18469-RA | 1..509 | 1..509 | 2545 | 100 | Plus |
CG12699-RB | 976 | CG12699-RB | 231..335 | 108..212 | 225 | 80.9 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:57:25
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2R | 21145070 | chr2R | 13132824..13133332 | 509..1 | 2545 | 100 | Minus |
chr2R | 21145070 | chr2R | 13134074..13134178 | 212..108 | 225 | 81 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:02:47 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:57:23
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 17245765..17246277 | 513..1 | 2565 | 100 | Minus |
2R | 25286936 | 2R | 17247028..17247132 | 212..108 | 225 | 81 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:05:26
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25260384 | 2R | 17246964..17247476 | 513..1 | 2565 | 100 | Minus |
2R | 25260384 | 2R | 17248227..17248331 | 212..108 | 225 | 80.9 | Minus |
Blast to na_te.dros performed 2019-03-16 13:57:24
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
copia | 5143 | copia DMCOPIA 5143bp Derived from X02599 (g7740) (Rel. 49, Last updated, Version 4). | 4648..4693 | 381..425 | 110 | 76.6 | Plus |
AT30190.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:58:29 Download gff for
AT30190.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2R | 13132824..13133332 | 1..509 | 100 | | Minus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:30:37 Download gff for
AT30190.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG18469-RA | 1..387 | 9..395 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:38:45 Download gff for
AT30190.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG18469-RA | 1..387 | 9..395 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 15:19:02 Download gff for
AT30190.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG18469-RA | 1..387 | 9..395 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:15:37 Download gff for
AT30190.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG18469-RA | 1..387 | 9..395 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:21:28 Download gff for
AT30190.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG18469-RA | 1..387 | 9..395 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:43:14 Download gff for
AT30190.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG18469-RA | 1..509 | 1..509 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:38:45 Download gff for
AT30190.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG18469-RA | 1..509 | 1..509 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 15:19:02 Download gff for
AT30190.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG18469-RA | 1..509 | 1..509 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:15:37 Download gff for
AT30190.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG18469-RA | 1..509 | 1..509 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:21:28 Download gff for
AT30190.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG18469-RA | 1..509 | 1..509 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:58:29 Download gff for
AT30190.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 17245769..17246277 | 1..509 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:58:29 Download gff for
AT30190.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 17245769..17246277 | 1..509 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:58:29 Download gff for
AT30190.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 17245769..17246277 | 1..509 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 15:19:02 Download gff for
AT30190.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 13133274..13133782 | 1..509 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:51:32 Download gff for
AT30190.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 17246968..17247476 | 1..509 | 100 | | Minus |
AT30190.hyp Sequence
Translation from 2 to 394
> AT30190.hyp
YNMSESASEDTDSEGVAAVPVPDTTPRDADATTSGARMMMQHPWLTAAGV
AVYATRVIWVKLRVLRLAKQLRLQKQRFWKSNPWQDNESGSEAESDTDGE
EGDSDESTDTDVNRNRIEATDNDRLVRVPQ*
AT30190.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:24:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG18469-PA | 128 | CG18469-PA | 1..128 | 3..130 | 663 | 100 | Plus |
CG12699-PB | 145 | CG12699-PB | 1..119 | 3..118 | 229 | 45.9 | Plus |
AT30190.pep Sequence
Translation from 8 to 394
> AT30190.pep
MSESASEDTDSEGVAAVPVPDTTPRDADATTSGARMMMQHPWLTAAGVAV
YATRVIWVKLRVLRLAKQLRLQKQRFWKSNPWQDNESGSEAESDTDGEEG
DSDESTDTDVNRNRIEATDNDRLVRVPQ*
AT30190.pep Blast Records
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 21:57:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG22206-PA | 146 | GG22206-PA | 4..137 | 2..127 | 359 | 65.7 | Plus |
Dere\GG22205-PA | 132 | GG22205-PA | 13..81 | 14..84 | 154 | 62 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:39:34
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG18469-PA | 128 | CG18469-PA | 1..128 | 1..128 | 663 | 100 | Plus |
CG12699-PB | 145 | CG12699-PB | 1..119 | 1..116 | 229 | 45.9 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 21:57:57
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM19993-PA | 124 | GM19993-PA | 1..124 | 1..128 | 443 | 84.7 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 21:57:57
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD25485-PA | 131 | GD25485-PA | 1..131 | 1..128 | 537 | 88.5 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 21:57:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE14204-PA | 133 | GE14204-PA | 1..125 | 1..124 | 311 | 63.1 | Plus |