Clone AT30190 Report

Search the DGRC for AT30190

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:301
Well:90
Vector:pOTB7
Associated Gene/TranscriptCG18469-RA
Protein status:AT30190.pep: gold
Preliminary Size:747
Sequenced Size:527

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG18469 2002-01-01 Sim4 clustering to Release 2
CG18469 2003-01-01 Sim4 clustering to Release 3
CG18469 2003-01-22 Blastp of sequenced clone
CG18469 2008-04-29 Release 5.5 accounting
CG18469 2008-08-15 Release 5.9 accounting
CG18469 2008-12-18 5.12 accounting

Clone Sequence Records

AT30190.complete Sequence

527 bp (527 high quality bases) assembled on 2003-01-22

GenBank Submission: AY075279

> AT30190.complete
AATACAACATGAGTGAGTCCGCATCTGAGGACACAGATTCTGAAGGGGTT
GCTGCCGTGCCAGTTCCCGATACCACGCCTCGCGATGCGGACGCCACAAC
TTCCGGAGCCCGGATGATGATGCAACACCCATGGTTGACGGCAGCCGGAG
TTGCCGTCTATGCCACCAGAGTCATTTGGGTCAAGTTGCGTGTGCTCCGG
TTGGCCAAACAGTTGCGCCTCCAGAAGCAAAGATTTTGGAAGTCTAATCC
CTGGCAGGACAATGAATCTGGCTCTGAGGCAGAGAGTGATACCGATGGCG
AGGAAGGCGATTCTGACGAGTCTACAGATACAGATGTGAATCGTAATAGA
ATTGAAGCTACTGATAATGATCGGTTAGTCCGAGTGCCGCAATAGTTTTT
CAAGATGTTTTTCGAATTTAAATTCAATGCTGCAAGTTATTAACATTGTT
AGCTGGATTAGAGGGTACCATATGCTTTAAAATACAAATCGTTTCTCATA
TTCAATTTTAAAAAAAAAAAAAAAAAA

AT30190.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:44:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG18469-RA 509 CG18469-RA 1..509 1..509 2545 100 Plus
CG12699-RB 976 CG12699-RB 231..335 108..212 225 80.9 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:57:25
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 13132824..13133332 509..1 2545 100 Minus
chr2R 21145070 chr2R 13134074..13134178 212..108 225 81 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:02:47 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:57:23
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 17245765..17246277 513..1 2565 100 Minus
2R 25286936 2R 17247028..17247132 212..108 225 81 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:05:26
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 17246964..17247476 513..1 2565 100 Minus
2R 25260384 2R 17248227..17248331 212..108 225 80.9 Minus
Blast to na_te.dros performed 2019-03-16 13:57:24
Subject Length Description Subject Range Query Range Score Percent Strand
copia 5143 copia DMCOPIA 5143bp Derived from X02599 (g7740) (Rel. 49, Last updated, Version 4). 4648..4693 381..425 110 76.6 Plus

AT30190.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:58:29 Download gff for AT30190.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 13132824..13133332 1..509 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:30:37 Download gff for AT30190.complete
Subject Subject Range Query Range Percent Splice Strand
CG18469-RA 1..387 9..395 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:38:45 Download gff for AT30190.complete
Subject Subject Range Query Range Percent Splice Strand
CG18469-RA 1..387 9..395 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 15:19:02 Download gff for AT30190.complete
Subject Subject Range Query Range Percent Splice Strand
CG18469-RA 1..387 9..395 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:15:37 Download gff for AT30190.complete
Subject Subject Range Query Range Percent Splice Strand
CG18469-RA 1..387 9..395 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:21:28 Download gff for AT30190.complete
Subject Subject Range Query Range Percent Splice Strand
CG18469-RA 1..387 9..395 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:43:14 Download gff for AT30190.complete
Subject Subject Range Query Range Percent Splice Strand
CG18469-RA 1..509 1..509 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:38:45 Download gff for AT30190.complete
Subject Subject Range Query Range Percent Splice Strand
CG18469-RA 1..509 1..509 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 15:19:02 Download gff for AT30190.complete
Subject Subject Range Query Range Percent Splice Strand
CG18469-RA 1..509 1..509 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:15:37 Download gff for AT30190.complete
Subject Subject Range Query Range Percent Splice Strand
CG18469-RA 1..509 1..509 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:21:28 Download gff for AT30190.complete
Subject Subject Range Query Range Percent Splice Strand
CG18469-RA 1..509 1..509 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:58:29 Download gff for AT30190.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17245769..17246277 1..509 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:58:29 Download gff for AT30190.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17245769..17246277 1..509 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:58:29 Download gff for AT30190.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17245769..17246277 1..509 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 15:19:02 Download gff for AT30190.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 13133274..13133782 1..509 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:51:32 Download gff for AT30190.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17246968..17247476 1..509 100   Minus

AT30190.hyp Sequence

Translation from 2 to 394

> AT30190.hyp
YNMSESASEDTDSEGVAAVPVPDTTPRDADATTSGARMMMQHPWLTAAGV
AVYATRVIWVKLRVLRLAKQLRLQKQRFWKSNPWQDNESGSEAESDTDGE
EGDSDESTDTDVNRNRIEATDNDRLVRVPQ*

AT30190.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:24:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG18469-PA 128 CG18469-PA 1..128 3..130 663 100 Plus
CG12699-PB 145 CG12699-PB 1..119 3..118 229 45.9 Plus

AT30190.pep Sequence

Translation from 8 to 394

> AT30190.pep
MSESASEDTDSEGVAAVPVPDTTPRDADATTSGARMMMQHPWLTAAGVAV
YATRVIWVKLRVLRLAKQLRLQKQRFWKSNPWQDNESGSEAESDTDGEEG
DSDESTDTDVNRNRIEATDNDRLVRVPQ*

AT30190.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 21:57:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22206-PA 146 GG22206-PA 4..137 2..127 359 65.7 Plus
Dere\GG22205-PA 132 GG22205-PA 13..81 14..84 154 62 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:39:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG18469-PA 128 CG18469-PA 1..128 1..128 663 100 Plus
CG12699-PB 145 CG12699-PB 1..119 1..116 229 45.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 21:57:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19993-PA 124 GM19993-PA 1..124 1..128 443 84.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 21:57:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25485-PA 131 GD25485-PA 1..131 1..128 537 88.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 21:57:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14204-PA 133 GE14204-PA 1..125 1..124 311 63.1 Plus