Clone AT30334 Report

Search the DGRC for AT30334

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:303
Well:34
Vector:pOTB7
Associated Gene/TranscriptCG17118-RA
Protein status:AT30334.pep: gold
Preliminary Size:890
Sequenced Size:991

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17118 2002-01-01 Sim4 clustering to Release 2
CG17118 2003-01-22 Blastp of sequenced clone
CG17118 2008-04-29 Release 5.5 accounting
CG17118 2008-08-15 Release 5.9 accounting
CG17118 2008-12-18 5.12 accounting

Clone Sequence Records

AT30334.complete Sequence

991 bp (991 high quality bases) assembled on 2003-01-22

GenBank Submission: AY075283

> AT30334.complete
AAACCACACACACAGTTTCAAAATATACAACCGACAATGTATCGTGCAGC
CTATCAAAAAGGTTTCCTTACCGTGCTTTACAGCGTAGGCAGTTCGCCCC
TGAACAACTGGTCTTCCTATACCAAAAACGGGTATATCAAACGGATCTAC
GATGAGGACATCAAGTCCCTGGTGCTCGAGATAATGGGCTCAAATGTGTC
CACCACATTCATACACTGCCCCAGCGAATGCAAGGAGCAGCTGGGCATCA
AGTTGCCCTTCCTGGTGCTCCTTATAAAGAACATGCACAAGTACTTTTGC
TTCGAAGTTAAGATTCAAGACGATCAGCGCTTCATGCGCCGTTTCCGAGT
GTCCAATTTCCAGAGCAAGACCTCCGTGAAGCCCTTCTGCACGGCGATGC
CGATGGGCATGTCACCGGGCTGGAACCAGATCCAGTTTAACCTGGCCGAC
TTCACGCGCCGTGCTTACGGCTCCAACTATCTGGAGACGGTATCCTTGCA
GCTGCATGCCAACGTACGCATCCGGCGCATCTACTTCGCCGATAAGCTAT
ACACAGAGGCTGAATTGCCCAATGACTACCGTCTGATGGGCAAGCCGAAG
GATCTGAAGAAGCCGGAGAAGCAGTTCAAGGTGCAGGCCACTGCGCGTCC
TCCGTCGCCTTTGAACACGGGTCGCGGTGAACCCGGACCCTCCAAAGACA
CGGACGCAGAGGCAACAGGTCCCGCCACGGATCCGATGAGTGAGCCGGAG
CCTGCGCTGCAGAAGTCTCCGTCGCCGCCTGTTCCGCAGAAGGTTCCGTC
GCCAGCAGCTTCCGCTCCTCCAGAGCCGGCCACCGAGGAGCCAGCTCCAC
AAACGGAGGCCACCGAAGAGGCCTACTATTAAGTTACGTTGCACAGTTGC
TTGTTTTTATCGTTCTGTTGACACGCGACTGGGAGTGGCACATAGTTTAA
ATTTCCAGTCATAGCAATCATAAAAAAAAAAAAAAAAAAAA

AT30334.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:24:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG17118-RA 987 CG17118-RA 9..981 1..973 4820 99.6 Plus
CG5343-RA 1064 CG5343-RA 688..759 417..488 225 87.5 Plus
CG6443-RA 1188 CG6443-RA 1148..1188 1..41 205 100 Plus
CG5343-RA 1064 CG5343-RA 511..587 240..316 175 81.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 14:05:22
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 10729465..10730125 311..971 3260 99.5 Plus
chr2L 23010047 chr2L 10729209..10729400 121..312 960 100 Plus
chr2L 23010047 chr2L 10729032..10729151 1..120 600 100 Plus
chr2L 23010047 chr2L 10429041..10429112 488..417 225 87.5 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:02:54 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 14:05:20
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10730696..10731358 311..973 3270 99.5 Plus
2L 23513712 2L 10730440..10730631 121..312 960 100 Plus
2L 23513712 2L 10730263..10730382 1..120 600 100 Plus
2L 23513712 2L 10430207..10430278 488..417 225 87.5 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:02:27
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10730696..10731358 311..973 3270 99.5 Plus
2L 23513712 2L 10730440..10730631 121..312 960 100 Plus
2L 23513712 2L 10730263..10730382 1..120 600 100 Plus
2L 23513712 2L 10430207..10430278 488..417 225 87.5 Minus
2L 23513712 2L 10430442..10430511 309..240 170 82.8 Minus
Blast to na_te.dros performed on 2019-03-16 14:05:20 has no hits.

AT30334.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 14:06:02 Download gff for AT30334.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 10729032..10729151 1..120 100 -> Plus
chr2L 10729209..10729400 121..312 100 -> Plus
chr2L 10729467..10730125 313..971 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:30:45 Download gff for AT30334.complete
Subject Subject Range Query Range Percent Splice Strand
CG17118-RA 1..846 37..882 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:55:18 Download gff for AT30334.complete
Subject Subject Range Query Range Percent Splice Strand
CG17118-RA 1..846 37..882 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 15:26:41 Download gff for AT30334.complete
Subject Subject Range Query Range Percent Splice Strand
CG17118-RA 1..846 37..882 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:46:19 Download gff for AT30334.complete
Subject Subject Range Query Range Percent Splice Strand
CG17118-RA 1..846 37..882 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:23:04 Download gff for AT30334.complete
Subject Subject Range Query Range Percent Splice Strand
CG17118-RA 1..846 37..882 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:10:34 Download gff for AT30334.complete
Subject Subject Range Query Range Percent Splice Strand
CG17118-RA 9..979 1..971 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:55:18 Download gff for AT30334.complete
Subject Subject Range Query Range Percent Splice Strand
CG17118-RA 9..979 1..971 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 15:26:41 Download gff for AT30334.complete
Subject Subject Range Query Range Percent Splice Strand
CG17118-RA 9..979 1..971 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:46:19 Download gff for AT30334.complete
Subject Subject Range Query Range Percent Splice Strand
CG17118-RA 9..979 1..971 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:23:04 Download gff for AT30334.complete
Subject Subject Range Query Range Percent Splice Strand
CG17118-RA 9..979 1..971 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:06:02 Download gff for AT30334.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10730263..10730382 1..120 100 -> Plus
2L 10730440..10730631 121..312 100 -> Plus
2L 10730698..10731356 313..971 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:06:02 Download gff for AT30334.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10730263..10730382 1..120 100 -> Plus
2L 10730440..10730631 121..312 100 -> Plus
2L 10730698..10731356 313..971 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:06:02 Download gff for AT30334.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10730263..10730382 1..120 100 -> Plus
2L 10730440..10730631 121..312 100 -> Plus
2L 10730698..10731356 313..971 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 15:26:41 Download gff for AT30334.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 10730263..10730382 1..120 100 -> Plus
arm_2L 10730440..10730631 121..312 100 -> Plus
arm_2L 10730698..10731356 313..971 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:17:24 Download gff for AT30334.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10730698..10731356 313..971 99   Plus
2L 10730263..10730382 1..120 100 -> Plus
2L 10730440..10730631 121..312 100 -> Plus

AT30334.hyp Sequence

Translation from 1 to 881

> AT30334.hyp
KPHTQFQNIQPTMYRAAYQKGFLTVLYSVGSSPLNNWSSYTKNGYIKRIY
DEDIKSLVLEIMGSNVSTTFIHCPSECKEQLGIKLPFLVLLIKNMHKYFC
FEVKIQDDQRFMRRFRVSNFQSKTSVKPFCTAMPMGMSPGWNQIQFNLAD
FTRRAYGSNYLETVSLQLHANVRIRRIYFADKLYTEAELPNDYRLMGKPK
DLKKPEKQFKVQATARPPSPLNTGRGEPGPSKDTDAEATGPATDPMSEPE
PALQKSPSPPVPQKVPSPAASAPPEPATEEPAPQTEATEEAYY*

AT30334.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:24:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG17118-PA 281 CG17118-PA 1..281 13..293 1490 100 Plus
Bug22-PA 199 CG5343-PA 1..183 13..195 642 62.8 Plus

AT30334.pep Sequence

Translation from 36 to 881

> AT30334.pep
MYRAAYQKGFLTVLYSVGSSPLNNWSSYTKNGYIKRIYDEDIKSLVLEIM
GSNVSTTFIHCPSECKEQLGIKLPFLVLLIKNMHKYFCFEVKIQDDQRFM
RRFRVSNFQSKTSVKPFCTAMPMGMSPGWNQIQFNLADFTRRAYGSNYLE
TVSLQLHANVRIRRIYFADKLYTEAELPNDYRLMGKPKDLKKPEKQFKVQ
ATARPPSPLNTGRGEPGPSKDTDAEATGPATDPMSEPEPALQKSPSPPVP
QKVPSPAASAPPEPATEEPAPQTEATEEAYY*

AT30334.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:28:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15822-PA 272 GF15822-PA 1..242 1..243 1196 92.2 Plus
Dana\GF14097-PA 199 GF14097-PA 1..184 1..184 667 62.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:28:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23671-PA 277 GG23671-PA 1..277 1..281 1434 95.7 Plus
Dere\GG23930-PA 199 GG23930-PA 1..184 1..184 667 62.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 08:28:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10426-PA 269 GH10426-PA 1..267 1..275 1115 77.5 Plus
Dgri\GH13299-PA 199 GH13299-PA 1..184 1..184 667 62.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:26:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG17118-PA 281 CG17118-PA 1..281 1..281 1490 100 Plus
Bug22-PA 199 CG5343-PA 1..183 1..183 642 62.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 08:28:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23484-PA 271 GI23484-PA 1..271 1..281 1139 77 Plus
Dmoj\GI18163-PA 199 GI18163-PA 1..184 1..184 667 62.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 08:28:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26630-PA 274 GL26630-PA 1..274 1..281 1182 84.3 Plus
Dper\GL18997-PA 199 GL18997-PA 1..184 1..184 638 61.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 08:28:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14331-PA 274 GA14331-PA 1..274 1..281 1182 84.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:28:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18720-PA 281 GM18720-PA 1..281 1..281 1502 99.6 Plus
Dsec\GM11664-PA 199 GM11664-PA 1..184 1..184 667 62.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:28:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23728-PA 232 GD23728-PA 1..232 50..281 1243 100 Plus
Dsim\GD11616-PA 246 GD11616-PA 1..141 1..141 777 100 Plus
Dsim\GD22257-PA 199 GD22257-PA 1..184 1..184 667 62.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 08:28:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20690-PA 273 GJ20690-PA 1..272 1..281 1130 77.4 Plus
Dvir\GJ14593-PA 199 GJ14593-PA 1..184 1..184 667 62.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 08:28:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14668-PA 286 GK14668-PA 1..286 1..281 1146 77.4 Plus
Dwil\GK15261-PA 199 GK15261-PA 1..184 1..184 667 62.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:28:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18484-PA 277 GE18484-PA 1..277 1..281 1430 95.7 Plus
Dyak\GE25932-PA 199 GE25932-PA 1..184 1..184 667 62.5 Plus