Clone AT30494 Report

Search the DGRC for AT30494

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:304
Well:94
Vector:pOTB7
Associated Gene/TranscriptProsalpha6T-RA
Protein status:AT30494.pep: gold
Preliminary Size:870
Sequenced Size:1067

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5648 2002-01-01 Sim4 clustering to Release 2
CG5648 2003-01-01 Sim4 clustering to Release 3
CG5648 2003-01-22 Blastp of sequenced clone
Prosalpha6T 2008-04-29 Release 5.5 accounting
Prosalpha6T 2008-08-15 Release 5.9 accounting
Prosalpha6T 2008-12-18 5.12 accounting

Clone Sequence Records

AT30494.complete Sequence

1067 bp (1067 high quality bases) assembled on 2003-01-22

GenBank Submission: AY075285

> AT30494.complete
ACTCAAGCTAGATAAATTTGCAACTAACAAGCTAACGTTATTTCGCCGAA
TTCATTCACACTTTTGGCCATGTTCCGGAATCAGTATGACAACGACACAA
CCACTTGGAGTCCGCAGGGTCGTCTCTTCCAGGTGGAGTACGCAATGGAG
GCGGTGAAACAGGGAGCAGCCACCGTGGGACTCAAAGGCACCGACTATGC
CGTGCTGGCCGCCCTGTGCCGCACCTCAAAGGACACGAACACGCTCCAGC
GGAAGATCATGCCGGTGGATGACCACGTGGGTATGTCTATCGCAGGACTA
ACGGCAGATGCCCGCGTGGTGTGCCAGTACATGAGGACGGAGTGCATGGC
ATATCGGCACTCCTATAACGCAGAATTTCCGGTTCGCCGTTTGGTTTCCA
ATCTGGGTAACAAGCTGCAGACCACCACCCAGCGCTATGATCGTCGTCCC
TACGGTGTGGGCTTGCTGGTGGCTGGATACGATGAGCAGGGACCACATAT
CTACCAGGTGATGCCCACGGCCAATGTGCTCAACTGCAAGGCAATGGCCA
TTGGATCTCGTTCGCAGAGTGCTCGCACATATCTGGAGCGAAATATGGAG
AGTTTCGAGGACTGCGACATGGATGAACTGATATGTCATGCCATTCAGGC
CATTCGAGGATCGTTGGGTTCCGATGATGTCGAGAATCTCACCATAAATG
TGGCCATTGTGGGCAAGGATGTGCCGTTTAAAATGTTTACGGAAGCCGAG
AACCAGAAGTATGTGAAATTGGTCAAGGCTATGGATCCACCTCTGGAGGC
GGACCACGATCCTCTATCCGAGGAGGGAATGAGCGATGATGACATGACGG
ACCACGGACCGAGTAGCAGTGGAGTTCCACCCAATGATACATCTGACATG
GAAACCACTGCATCCACCGGCGGCAGTGACGCACATTGATCTAATCTGTG
ATTAGAAACCCTGACAGAGTATACTAAATTTATTGTTTCGTTAATAATGT
TATTAAAGTTTATAGTTATTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAA

AT30494.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:24:38
Subject Length Description Subject Range Query Range Score Percent Strand
Prosalpha6T-RA 1021 Prosalpha6T-RA 1..1021 1..1021 5060 99.7 Plus
Pros35-RA 1098 Pros35-RA 156..236 106..186 225 85.1 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:37:04
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 13230711..13231730 1..1020 5055 99.7 Plus
chr2L 23010047 chr2L 10220398..10220880 106..588 330 71.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:02:59 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:37:03
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 13232039..13233059 1..1021 5060 99.7 Plus
2L 23513712 2L 10221547..10222029 106..588 330 71.2 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:02:18
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 13232039..13233059 1..1021 5060 99.7 Plus
2L 23513712 2L 10221547..10221627 106..186 225 85.1 Plus
Blast to na_te.dros performed 2019-03-15 21:37:03
Subject Length Description Subject Range Query Range Score Percent Strand
invader6 4885 invader6 INVADER6 4885bp 3427..3491 86..22 126 69.7 Minus

AT30494.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:37:51 Download gff for AT30494.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 13230711..13231730 1..1020 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:30:51 Download gff for AT30494.complete
Subject Subject Range Query Range Percent Splice Strand
Prosalpha6T-RA 1..870 70..939 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:55:06 Download gff for AT30494.complete
Subject Subject Range Query Range Percent Splice Strand
Prosalpha6T-RA 1..870 70..939 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:54:33 Download gff for AT30494.complete
Subject Subject Range Query Range Percent Splice Strand
Prosalpha6T-RA 1..870 70..939 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:46:09 Download gff for AT30494.complete
Subject Subject Range Query Range Percent Splice Strand
Prosalpha6T-RA 1..870 70..939 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:59:24 Download gff for AT30494.complete
Subject Subject Range Query Range Percent Splice Strand
Prosalpha6T-RA 1..870 70..939 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:10:18 Download gff for AT30494.complete
Subject Subject Range Query Range Percent Splice Strand
Prosalpha6T-RA 1..1020 1..1020 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:55:06 Download gff for AT30494.complete
Subject Subject Range Query Range Percent Splice Strand
Prosalpha6T-RA 1..1020 1..1020 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:54:33 Download gff for AT30494.complete
Subject Subject Range Query Range Percent Splice Strand
Prosalpha6T-RA 1..1020 1..1020 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:46:09 Download gff for AT30494.complete
Subject Subject Range Query Range Percent Splice Strand
Prosalpha6T-RA 1..1020 1..1020 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:59:24 Download gff for AT30494.complete
Subject Subject Range Query Range Percent Splice Strand
Prosalpha6T-RA 1..1020 1..1020 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:37:51 Download gff for AT30494.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13232039..13233058 1..1020 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:37:51 Download gff for AT30494.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13232039..13233058 1..1020 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:37:51 Download gff for AT30494.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13232039..13233058 1..1020 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:54:33 Download gff for AT30494.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 13232039..13233058 1..1020 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:17:11 Download gff for AT30494.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13232039..13233058 1..1020 99   Plus

AT30494.hyp Sequence

Translation from 69 to 938

> AT30494.hyp
MFRNQYDNDTTTWSPQGRLFQVEYAMEAVKQGAATVGLKGTDYAVLAALC
RTSKDTNTLQRKIMPVDDHVGMSIAGLTADARVVCQYMRTECMAYRHSYN
AEFPVRRLVSNLGNKLQTTTQRYDRRPYGVGLLVAGYDEQGPHIYQVMPT
ANVLNCKAMAIGSRSQSARTYLERNMESFEDCDMDELICHAIQAIRGSLG
SDDVENLTINVAIVGKDVPFKMFTEAENQKYVKLVKAMDPPLEADHDPLS
EEGMSDDDMTDHGPSSSGVPPNDTSDMETTASTGGSDAH*

AT30494.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:25:01
Subject Length Description Subject Range Query Range Score Percent Strand
Prosalpha6T-PA 289 CG5648-PA 1..289 1..289 1517 100 Plus
Prosalpha6-PA 279 CG4904-PA 1..275 1..280 827 57.7 Plus
Prosalpha6-PB 279 CG4904-PB 1..275 1..280 827 57.7 Plus
Prosalpha4-PA 249 CG3422-PA 3..235 4..236 293 32.2 Plus
Prosalpha4T2-PB 252 CG4569-PB 4..222 5..222 291 32 Plus

AT30494.pep Sequence

Translation from 69 to 938

> AT30494.pep
MFRNQYDNDTTTWSPQGRLFQVEYAMEAVKQGAATVGLKGTDYAVLAALC
RTSKDTNTLQRKIMPVDDHVGMSIAGLTADARVVCQYMRTECMAYRHSYN
AEFPVRRLVSNLGNKLQTTTQRYDRRPYGVGLLVAGYDEQGPHIYQVMPT
ANVLNCKAMAIGSRSQSARTYLERNMESFEDCDMDELICHAIQAIRGSLG
SDDVENLTINVAIVGKDVPFKMFTEAENQKYVKLVKAMDPPLEADHDPLS
EEGMSDDDMTDHGPSSSGVPPNDTSDMETTASTGGSDAH*

AT30494.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:26:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23090-PA 317 GF23090-PA 1..289 1..281 1042 67.5 Plus
Dana\GF15751-PA 285 GF15751-PA 3..270 2..273 834 57.1 Plus
Dana\GF19028-PA 249 GF19028-PA 3..231 4..232 322 34.7 Plus
Dana\GF11246-PA 252 GF11246-PA 4..177 5..175 306 35.6 Plus
Dana\GF12213-PA 265 GF12213-PA 4..187 5..184 289 35.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:26:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23827-PA 289 GG23827-PA 1..288 1..288 1388 87.2 Plus
Dere\GG10092-PA 282 GG10092-PA 1..278 1..283 888 57.6 Plus
Dere\GG19922-PA 252 GG19922-PA 4..242 5..245 300 29.4 Plus
Dere\GG22074-PA 264 GG22074-PA 4..187 5..184 296 36.4 Plus
Dere\GG15180-PA 251 GG15180-PA 3..222 4..223 292 31.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 08:26:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13363-PA 288 GH13363-PA 1..242 1..236 856 62.4 Plus
Dgri\GH10812-PA 256 GH10812-PA 1..239 1..240 788 58.9 Plus
Dgri\GH20521-PA 263 GH20521-PA 4..202 5..199 299 34.7 Plus
Dgri\GH12557-PA 249 GH12557-PA 3..234 4..235 294 33.5 Plus
Dgri\GH13898-PA 234 GH13898-PA 1..209 1..205 287 30.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:26:02
Subject Length Description Subject Range Query Range Score Percent Strand
Prosalpha6T-PA 289 CG5648-PA 1..289 1..289 1517 100 Plus
Prosalpha6-PA 279 CG4904-PA 1..275 1..280 827 57.7 Plus
Prosalpha6-PB 279 CG4904-PB 1..275 1..280 827 57.7 Plus
Prosalpha4-PA 249 CG3422-PA 3..235 4..236 293 32.2 Plus
Prosalpha4T2-PB 252 CG4569-PB 4..222 5..222 291 32 Plus
Prosalpha4T2-PA 252 CG4569-PA 4..222 5..222 291 32 Plus
Prosalpha3-PA 264 CG9327-PA 4..184 5..181 288 37 Plus
Prosalpha5-PB 244 CG10938-PB 5..241 3..233 283 30.4 Plus
Prosalpha5-PA 244 CG10938-PA 5..241 3..233 283 30.4 Plus
Prosalpha4T1-PA 249 CG17268-PA 3..235 4..236 276 29.9 Plus
Prosalpha2-PA 234 CG5266-PA 1..209 1..205 270 30.7 Plus
Prosalpha3T-PA 251 CG1736-PA 5..240 6..236 257 30.1 Plus
Prosalpha1-PB 244 CG18495-PB 9..244 6..239 251 29.3 Plus
Prosalpha1-PA 244 CG18495-PA 9..244 6..239 251 29.3 Plus
CG30382-PB 244 CG30382-PB 9..244 6..239 251 29.3 Plus
CG30382-PA 244 CG30382-PA 9..244 6..239 251 29.3 Plus
Prosalpha7-PA 253 CG1519-PA 8..179 6..174 246 29.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 08:26:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18287-PA 287 GI18287-PA 5..272 2..267 873 58 Plus
Dmoj\GI17321-PA 295 GI17321-PA 1..284 1..283 798 52.9 Plus
Dmoj\GI21349-PA 189 GI21349-PA 15..174 45..204 619 63.7 Plus
Dmoj\GI11210-PA 249 GI11210-PA 3..234 4..235 304 34.2 Plus
Dmoj\GI21067-PA 263 GI21067-PA 4..202 5..199 302 35.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 08:26:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26311-PA 277 GL26311-PA 1..274 1..283 1035 69 Plus
Dper\GL18993-PA 281 GL18993-PA 1..269 1..268 900 58.9 Plus
Dper\GL24418-PA 225 GL24418-PA 3..211 62..258 454 43.5 Plus
Dper\GL20413-PA 252 GL20413-PA 3..242 4..245 302 30.8 Plus
Dper\GL10139-PA 262 GL10139-PA 4..202 5..199 290 34.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 08:26:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19030-PA 277 GA19030-PA 1..274 1..283 1039 69.4 Plus
Dpse\GA30476-PA 262 GA30476-PA 1..240 1..239 661 53.7 Plus
Dpse\GA23615-PA 253 GA23615-PA 1..246 26..264 516 44.2 Plus
Dpse\GA25292-PA 249 GA25292-PA 3..235 4..236 305 32.2 Plus
Dpse\GA17441-PA 249 GA17441-PA 3..231 4..232 304 32.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:26:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10300-PA 270 GM10300-PA 1..270 1..289 1365 87.9 Plus
Dsec\GM18005-PA 281 GM18005-PA 1..242 1..236 892 66.5 Plus
Dsec\Pros28.1B-PA 252 GM11825-PA 3..242 4..245 304 30.5 Plus
Dsec\GM21770-PA 244 GM21770-PA 5..241 3..233 295 30.7 Plus
Dsec\GM15792-PA 264 GM15792-PA 4..179 5..176 294 37.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:26:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23876-PA 289 GD23876-PA 1..289 1..289 1485 93.8 Plus
Dsim\GD23664-PA 281 GD23664-PA 1..242 1..236 892 66.5 Plus
Dsim\Pros28.1B-PA 252 GD24946-PA 3..242 4..245 297 30.5 Plus
Dsim\GD11553-PA 264 GD11553-PA 4..179 5..176 294 37.5 Plus
Dsim\GD11263-PA 244 GD11263-PA 5..241 3..233 292 30.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 08:26:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15428-PA 286 GJ15428-PA 1..243 1..236 879 63.8 Plus
Dvir\GJ15897-PA 273 GJ15897-PA 1..237 1..239 809 60.7 Plus
Dvir\GJ20726-PA 251 GJ20726-PA 5..243 6..244 316 33.7 Plus
Dvir\Pros28.1-PA 249 GJ18504-PA 3..234 4..235 303 33.9 Plus
Dvir\GJ21990-PA 263 GJ21990-PA 4..198 5..195 300 35.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 08:26:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14549-PA 296 GK14549-PA 1..240 1..241 911 66.8 Plus
Dwil\GK23128-PA 249 GK23128-PA 1..211 2..212 824 67.3 Plus
Dwil\GK19681-PA 255 GK19681-PA 4..243 5..244 301 33.5 Plus
Dwil\GK22956-PA 262 GK22956-PA 4..202 5..199 299 35.2 Plus
Dwil\GK25669-PA 249 GK25669-PA 4..234 5..235 296 33.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:26:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18630-PA 289 GE18630-PA 1..288 1..288 1370 86.5 Plus
Dyak\Pros35-PA 286 GE18906-PA 5..245 2..236 860 63.1 Plus
Dyak\GE11446-PA 252 GE11446-PA 3..223 4..223 309 32.1 Plus
Dyak\GE12155-PA 264 GE12155-PA 4..187 5..184 296 36.4 Plus
Dyak\ProsMA5-PA 244 GE11658-PA 5..240 3..232 292 32.4 Plus