AT30660.complete Sequence
618 bp (618 high quality bases) assembled on 2003-01-22
GenBank Submission: AY089485
> AT30660.complete
GGCAACAATTTACAATATGAACTGCATATTTCTTATGTGCTCCCTGCTTG
GCATCTCTTTCGCTATAGTGATCGAGGCCAACTGTCTGCGGGGTACAGGC
CACATGTGGCAGCAGAAGCCACCCACCAGCACAAACAGTTGCAATCGACC
GTTATCTCTGGCTAGAAATGGAACATCAATGGGAAAACGAGCAACGTCTG
CAGTCGACATTCCAGTAGCTACAATGGGAGCACCAGGTCCGGAGGTTGAA
GCAACCTTAGCTGCTCCTCCTGCGGTGTTTCTGGCCAACTACGTCTATGA
GTGCGCCATTCGTCGCACTGCAAACAGTTGCAGCAGACCACCAGGGTCGG
AGCCGGAATCGAAGCCGGAACTTGAATCCGGACCGGAGGTGCCTAAGCCC
CGAACTGTGACACTGGCAGCCGGCGAACTGGAAGGGTTCGGGCCAACTGA
GTGAAAGGGGTTTTGCATGCGATTAGACCAGCTGATGGGACGGGTGATGT
TAGCCCGGTTTTTTACATATATATACACTGGCATATATTTCGTACGGCAA
TAAAGTTAGGCAAAACAAGTTGGGAAACTCGTGAGAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAA
AT30660.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 18:24:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31093-RA | 747 | CG31093-RA | 162..747 | 1..586 | 2930 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 03:25:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3R | 27901430 | chr3R | 21612820..21613343 | 585..62 | 2620 | 100 | Minus |
chr3R | 27901430 | chr3R | 21613411..21613472 | 62..1 | 310 | 100 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:03:09 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 03:25:44
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 25789818..25790342 | 586..62 | 2625 | 100 | Minus |
3R | 32079331 | 3R | 25790410..25790471 | 62..1 | 310 | 100 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:02:10
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 31820162 | 3R | 25530649..25531173 | 586..62 | 2625 | 100 | Minus |
3R | 31820162 | 3R | 25531241..25531302 | 62..1 | 310 | 100 | Minus |
Blast to na_te.dros performed on 2019-03-16 03:25:45 has no hits.
AT30660.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 03:27:00 Download gff for
AT30660.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3R | 21612820..21613342 | 63..585 | 100 | <- | Minus |
chr3R | 21613411..21613472 | 1..62 | 100 | | Minus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:31:05 Download gff for
AT30660.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31093-RA | 1..438 | 17..454 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:54:53 Download gff for
AT30660.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31093-RA | 1..438 | 17..454 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:58:04 Download gff for
AT30660.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31093-RA | 1..438 | 17..454 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:45:55 Download gff for
AT30660.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31093-RA | 1..438 | 17..454 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:37:26 Download gff for
AT30660.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31093-RA | 1..438 | 17..454 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:10:00 Download gff for
AT30660.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31093-RA | 1..585 | 1..585 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:54:53 Download gff for
AT30660.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31093-RA | 1..585 | 1..585 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:58:04 Download gff for
AT30660.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31093-RA | 1..585 | 1..585 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:45:55 Download gff for
AT30660.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31093-RA | 1..585 | 1..585 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:37:26 Download gff for
AT30660.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31093-RA | 1..585 | 1..585 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:27:00 Download gff for
AT30660.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 25789819..25790341 | 63..585 | 100 | <- | Minus |
3R | 25790410..25790471 | 1..62 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:27:00 Download gff for
AT30660.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 25789819..25790341 | 63..585 | 100 | <- | Minus |
3R | 25790410..25790471 | 1..62 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:27:00 Download gff for
AT30660.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 25789819..25790341 | 63..585 | 100 | <- | Minus |
3R | 25790410..25790471 | 1..62 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:58:04 Download gff for
AT30660.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 21615541..21616063 | 63..585 | 100 | <- | Minus |
arm_3R | 21616132..21616193 | 1..62 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:16:58 Download gff for
AT30660.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 25530650..25531172 | 63..585 | 100 | <- | Minus |
3R | 25531241..25531302 | 1..62 | 100 | | Minus |
AT30660.hyp Sequence
Translation from 1 to 453
> AT30660.hyp
ATIYNMNCIFLMCSLLGISFAIVIEANCLRGTGHMWQQKPPTSTNSCNRP
LSLARNGTSMGKRATSAVDIPVATMGAPGPEVEATLAAPPAVFLANYVYE
CAIRRTANSCSRPPGSEPESKPELESGPEVPKPRTVTLAAGELEGFGPTE
*
AT30660.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:25:14
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31093-PA | 145 | CG31093-PA | 1..145 | 6..150 | 765 | 100 | Plus |
AT30660.pep Sequence
Translation from 16 to 453
> AT30660.pep
MNCIFLMCSLLGISFAIVIEANCLRGTGHMWQQKPPTSTNSCNRPLSLAR
NGTSMGKRATSAVDIPVATMGAPGPEVEATLAAPPAVFLANYVYECAIRR
TANSCSRPPGSEPESKPELESGPEVPKPRTVTLAAGELEGFGPTE*
AT30660.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:24:14
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF19936-PA | 148 | GF19936-PA | 1..125 | 1..119 | 222 | 47.7 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:24:14
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG12214-PA | 147 | GG12214-PA | 1..147 | 1..145 | 613 | 83.7 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:07:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31093-PA | 145 | CG31093-PA | 1..145 | 1..145 | 765 | 100 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:24:17
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM10215-PA | 145 | GM10215-PA | 1..145 | 1..145 | 673 | 91 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:24:17
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD18166-PA | 145 | GD18166-PA | 1..145 | 1..145 | 669 | 90.3 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:24:18
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE10661-PA | 155 | GE10661-PA | 1..155 | 1..145 | 605 | 81.3 | Plus |