Clone AT30660 Report

Search the DGRC for AT30660

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:306
Well:60
Vector:pOTB7
Associated Gene/TranscriptCG31093-RA
Protein status:AT30660.pep: gold
Preliminary Size:1626
Sequenced Size:618

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4964 2002-01-01 Sim4 clustering to Release 2
CG31093 2003-01-01 Sim4 clustering to Release 3
CG31093 2003-01-22 Blastp of sequenced clone
CG31093 2008-04-29 Release 5.5 accounting
CG31093 2008-08-15 Release 5.9 accounting
CG31093 2008-12-18 5.12 accounting

Clone Sequence Records

AT30660.complete Sequence

618 bp (618 high quality bases) assembled on 2003-01-22

GenBank Submission: AY089485

> AT30660.complete
GGCAACAATTTACAATATGAACTGCATATTTCTTATGTGCTCCCTGCTTG
GCATCTCTTTCGCTATAGTGATCGAGGCCAACTGTCTGCGGGGTACAGGC
CACATGTGGCAGCAGAAGCCACCCACCAGCACAAACAGTTGCAATCGACC
GTTATCTCTGGCTAGAAATGGAACATCAATGGGAAAACGAGCAACGTCTG
CAGTCGACATTCCAGTAGCTACAATGGGAGCACCAGGTCCGGAGGTTGAA
GCAACCTTAGCTGCTCCTCCTGCGGTGTTTCTGGCCAACTACGTCTATGA
GTGCGCCATTCGTCGCACTGCAAACAGTTGCAGCAGACCACCAGGGTCGG
AGCCGGAATCGAAGCCGGAACTTGAATCCGGACCGGAGGTGCCTAAGCCC
CGAACTGTGACACTGGCAGCCGGCGAACTGGAAGGGTTCGGGCCAACTGA
GTGAAAGGGGTTTTGCATGCGATTAGACCAGCTGATGGGACGGGTGATGT
TAGCCCGGTTTTTTACATATATATACACTGGCATATATTTCGTACGGCAA
TAAAGTTAGGCAAAACAAGTTGGGAAACTCGTGAGAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAA

AT30660.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:24:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG31093-RA 747 CG31093-RA 162..747 1..586 2930 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 03:25:47
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 21612820..21613343 585..62 2620 100 Minus
chr3R 27901430 chr3R 21613411..21613472 62..1 310 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:03:09 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 03:25:44
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 25789818..25790342 586..62 2625 100 Minus
3R 32079331 3R 25790410..25790471 62..1 310 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:02:10
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 25530649..25531173 586..62 2625 100 Minus
3R 31820162 3R 25531241..25531302 62..1 310 100 Minus
Blast to na_te.dros performed on 2019-03-16 03:25:45 has no hits.

AT30660.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 03:27:00 Download gff for AT30660.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 21612820..21613342 63..585 100 <- Minus
chr3R 21613411..21613472 1..62 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:31:05 Download gff for AT30660.complete
Subject Subject Range Query Range Percent Splice Strand
CG31093-RA 1..438 17..454 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:54:53 Download gff for AT30660.complete
Subject Subject Range Query Range Percent Splice Strand
CG31093-RA 1..438 17..454 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:58:04 Download gff for AT30660.complete
Subject Subject Range Query Range Percent Splice Strand
CG31093-RA 1..438 17..454 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:45:55 Download gff for AT30660.complete
Subject Subject Range Query Range Percent Splice Strand
CG31093-RA 1..438 17..454 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:37:26 Download gff for AT30660.complete
Subject Subject Range Query Range Percent Splice Strand
CG31093-RA 1..438 17..454 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:10:00 Download gff for AT30660.complete
Subject Subject Range Query Range Percent Splice Strand
CG31093-RA 1..585 1..585 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:54:53 Download gff for AT30660.complete
Subject Subject Range Query Range Percent Splice Strand
CG31093-RA 1..585 1..585 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:58:04 Download gff for AT30660.complete
Subject Subject Range Query Range Percent Splice Strand
CG31093-RA 1..585 1..585 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:45:55 Download gff for AT30660.complete
Subject Subject Range Query Range Percent Splice Strand
CG31093-RA 1..585 1..585 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:37:26 Download gff for AT30660.complete
Subject Subject Range Query Range Percent Splice Strand
CG31093-RA 1..585 1..585 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:27:00 Download gff for AT30660.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25789819..25790341 63..585 100 <- Minus
3R 25790410..25790471 1..62 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:27:00 Download gff for AT30660.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25789819..25790341 63..585 100 <- Minus
3R 25790410..25790471 1..62 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:27:00 Download gff for AT30660.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25789819..25790341 63..585 100 <- Minus
3R 25790410..25790471 1..62 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:58:04 Download gff for AT30660.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 21615541..21616063 63..585 100 <- Minus
arm_3R 21616132..21616193 1..62 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:16:58 Download gff for AT30660.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25530650..25531172 63..585 100 <- Minus
3R 25531241..25531302 1..62 100   Minus

AT30660.hyp Sequence

Translation from 1 to 453

> AT30660.hyp
ATIYNMNCIFLMCSLLGISFAIVIEANCLRGTGHMWQQKPPTSTNSCNRP
LSLARNGTSMGKRATSAVDIPVATMGAPGPEVEATLAAPPAVFLANYVYE
CAIRRTANSCSRPPGSEPESKPELESGPEVPKPRTVTLAAGELEGFGPTE
*

AT30660.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:25:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG31093-PA 145 CG31093-PA 1..145 6..150 765 100 Plus

AT30660.pep Sequence

Translation from 16 to 453

> AT30660.pep
MNCIFLMCSLLGISFAIVIEANCLRGTGHMWQQKPPTSTNSCNRPLSLAR
NGTSMGKRATSAVDIPVATMGAPGPEVEATLAAPPAVFLANYVYECAIRR
TANSCSRPPGSEPESKPELESGPEVPKPRTVTLAAGELEGFGPTE*

AT30660.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:24:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19936-PA 148 GF19936-PA 1..125 1..119 222 47.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:24:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12214-PA 147 GG12214-PA 1..147 1..145 613 83.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:07:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG31093-PA 145 CG31093-PA 1..145 1..145 765 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:24:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10215-PA 145 GM10215-PA 1..145 1..145 673 91 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:24:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18166-PA 145 GD18166-PA 1..145 1..145 669 90.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:24:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10661-PA 155 GE10661-PA 1..155 1..145 605 81.3 Plus