Clone AT30670 Report

Search the DGRC for AT30670

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:306
Well:70
Vector:pOTB7
Associated Gene/TranscriptCG46025-RB
Protein status:AT30670.pep: gold
Sequenced Size:1102

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7196 2002-11-07 Blastp of sequenced clone
CG7196 2008-04-29 Release 5.5 accounting
CG7196 2008-08-15 Release 5.9 accounting
CG7196 2008-12-18 5.12 accounting

Clone Sequence Records

AT30670.complete Sequence

1102 bp (1102 high quality bases) assembled on 2002-11-07

GenBank Submission: BT001367

> AT30670.complete
AAAAGTTAACAAAATTTGTAACGTTTGTTTAGCATCGATAACGAAGACTG
GCGGGAGTGCGAAAAGAGCCTGAAGGAGTTCCTCGAACAGGAGCGTGCCA
AAATGAAGGAGCGTTCGTTGCGCATATCCCAGCCCTACTCCTCGGATCCC
CAGGATATACAGAATATAGTCAGGGCCAGGCAAAAGTTCCGGGAGACCGA
GCTGCGTATTCGCAATCAGCTGGAGGACAAGCTAAAAGATGTCAAACTTG
CGGTCACCACTCAACAACTAACCGAACTTATCGAGGATGCCCATCGTTCC
AGCGGGGAGATCATCATGCCACAAGAACCTTCGATGGAGGACGATGACTT
CCAGGGCGGCGCAGTGAACTCCAAATATCTGGACGATGCCACCGATGTCT
CCGAGGAGACGGTGATCAGCGAGGATGCCATCAGCCTGACGCTGGCCAAG
CAGCAGTACGCGGAGGAACTGGAGGCCGAAATGGAGGACGAGTTCAATCG
AGGTCTGCTCATCTCCAAGCAGCAGTACGATCAGCTGCGCTTCGAGGATG
AGAAGATCGTGGCGCTCAGAAATGCCAAGGATATTCGCGAGCTGTATCAA
CTGGCCGAGGAGATCATCATGGGTGAGAACTACGTCGAGGCACCGGAGGA
GTGCGAGGAGGAGGCGGTGGTGGAGGAGCCGGAACAAGATATCTCCTCCG
ATCACGAGGCCCAGGAGCCAGCCAAAGCCTAATGAGAAGCTATAGAATAA
AACCATTTTTTACGTTCGGTGGACAGCGGCTGGTCGTTTATCCTGCTGCA
CCAGTTTTTAGCGAGTTCTACAATATTTGGCAAAATATTTGGTTTCCCAT
CCATGAGAGTCCAGATATTTCACCAAATCGTGCAAACATCAATTAGGCTG
GGGTACCTACCACAGTTTGTTAGACGTCGGAAGAGGTAGCGCAATCGAAA
AACGTTAGCTAAACTGTCACTCAATCTCAGCGTTTAGGTTGATAACTTGA
TAACTGTCAATGGGGTTTAATTAAAGCTGTAACGACTTGATTGTACCCGC
ATGACAACAAAAATAAAGCGGCCGAAAAATCCAAAAAAAAAAAAAAAAAA
AA

AT30670.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:35:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG7196-RB 1090 CG7196-RB 3..1088 2..1087 5370 99.6 Plus
CG7196-RA 2005 CG7196-RA 800..1859 32..1091 5225 99.5 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 23:38:38
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 7764299..7764803 578..1082 2525 100 Plus
chr2L 23010047 chr2L 7763840..7764242 178..580 2000 99.8 Plus
chr2L 23010047 chr2L 7763626..7763775 31..180 750 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:03:10 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 23:38:36
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 7765212..7765725 578..1091 2555 99.8 Plus
2L 23513712 2L 7764753..7765155 178..580 1955 99 Plus
2L 23513712 2L 7764539..7764688 31..180 750 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:10:08
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 7765212..7765725 578..1091 2555 99.8 Plus
2L 23513712 2L 7764753..7765155 178..580 1955 99 Plus
2L 23513712 2L 7764539..7764688 31..180 750 100 Plus
2L 23513712 2L 7764303..7764333 2..32 155 100 Plus
Blast to na_te.dros performed on 2019-03-16 23:38:36 has no hits.

AT30670.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 23:39:19 Download gff for AT30670.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 7763390..7763421 1..32 100 -> Plus
chr2L 7763628..7763774 33..179 100 -> Plus
chr2L 7763842..7764241 180..579 99 -> Plus
chr2L 7764301..7764803 580..1082 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:31:08 Download gff for AT30670.complete
Subject Subject Range Query Range Percent Splice Strand
CG7196-RA 620..1326 26..732 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:07:10 Download gff for AT30670.complete
Subject Subject Range Query Range Percent Splice Strand
CG7196-RA 620..1326 26..732 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:46:12 Download gff for AT30670.complete
Subject Subject Range Query Range Percent Splice Strand
CG7196-RA 620..1326 26..732 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:57:02 Download gff for AT30670.complete
Subject Subject Range Query Range Percent Splice Strand
CG7196-RA 620..1326 26..732 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:53:52 Download gff for AT30670.complete
Subject Subject Range Query Range Percent Splice Strand
CG46025-RC 620..1326 26..732 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:27:13 Download gff for AT30670.complete
Subject Subject Range Query Range Percent Splice Strand
CG7196-RB 1..1083 1..1082 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:07:10 Download gff for AT30670.complete
Subject Subject Range Query Range Percent Splice Strand
CG7196-RB 1..1083 1..1082 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:46:12 Download gff for AT30670.complete
Subject Subject Range Query Range Percent Splice Strand
CG7196-RB 1..1083 1..1082 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:57:03 Download gff for AT30670.complete
Subject Subject Range Query Range Percent Splice Strand
CG7196-RB 1..1083 1..1082 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:53:52 Download gff for AT30670.complete
Subject Subject Range Query Range Percent Splice Strand
CG46025-RB 1..1083 1..1082 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:39:19 Download gff for AT30670.complete
Subject Subject Range Query Range Percent Splice Strand
2L 7764301..7764333 1..32 96 -> Plus
2L 7764541..7764687 33..179 100 -> Plus
2L 7764755..7765154 180..579 99 -> Plus
2L 7765214..7765716 580..1082 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:39:19 Download gff for AT30670.complete
Subject Subject Range Query Range Percent Splice Strand
2L 7764301..7764333 1..32 96 -> Plus
2L 7764541..7764687 33..179 100 -> Plus
2L 7764755..7765154 180..579 99 -> Plus
2L 7765214..7765716 580..1082 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:39:19 Download gff for AT30670.complete
Subject Subject Range Query Range Percent Splice Strand
2L 7764301..7764333 1..32 96 -> Plus
2L 7764541..7764687 33..179 100 -> Plus
2L 7764755..7765154 180..579 99 -> Plus
2L 7765214..7765716 580..1082 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:46:12 Download gff for AT30670.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 7764301..7764333 1..32 96 -> Plus
arm_2L 7764541..7764687 33..179 100 -> Plus
arm_2L 7764755..7765154 180..579 99 -> Plus
arm_2L 7765214..7765716 580..1082 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:29:29 Download gff for AT30670.complete
Subject Subject Range Query Range Percent Splice Strand
2L 7764755..7765154 180..579 99 -> Plus
2L 7765214..7765716 580..1082 100   Plus
2L 7764301..7764333 1..32 96 -> Plus
2L 7764541..7764687 33..179 100 -> Plus

AT30670.pep Sequence

Translation from 102 to 731

> AT30670.pep
MKERSLRISQPYSSDPQDIQNIVRARQKFRETELRIRNQLEDKLKDVKLA
VTTQQLTELIEDAHRSSGEIIMPQEPSMEDDDFQGGAVNSKYLDDATDVS
EETVISEDAISLTLAKQQYAEELEAEMEDEFNRGLLISKQQYDQLRFEDE
KIVALRNAKDIRELYQLAEEIIMGENYVEAPEECEEEAVVEEPEQDISSD
HEAQEPAKA*

AT30670.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 07:59:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15320-PA 438 GF15320-PA 233..403 1..174 724 87.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 07:59:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10492-PA 439 GG10492-PA 233..439 1..209 834 89 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 07:59:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13673-PA 428 GH13673-PA 233..403 1..175 558 68.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:44:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG46025-PB 209 CG46025-PB 1..209 1..209 1041 100 Plus
CG46025-PA 441 CG46025-PA 233..441 1..209 1041 100 Plus
CG46025-PC 441 CG46025-PC 233..441 1..209 1041 100 Plus
CG46025-PD 596 CG46025-PD 388..596 1..209 1041 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 07:59:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17101-PA 434 GI17101-PA 233..406 1..175 524 63.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 07:59:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19282-PA 435 GL19282-PA 233..403 1..175 605 76 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 07:59:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20173-PA 435 GA20173-PA 233..403 1..175 605 76 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 07:59:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16547-PA 441 GM16547-PA 233..441 1..209 872 94.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 07:59:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23484-PA 441 GD23484-PA 233..441 1..209 891 96.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 07:59:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16139-PA 431 GJ16139-PA 233..405 1..175 589 70.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 07:59:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24405-PA 528 GK24405-PA 314..494 1..175 562 70.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 07:59:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14606-PA 439 GE14606-PA 233..439 1..209 845 88 Plus

AT30670.hyp Sequence

Translation from 102 to 731

> AT30670.hyp
MKERSLRISQPYSSDPQDIQNIVRARQKFRETELRIRNQLEDKLKDVKLA
VTTQQLTELIEDAHRSSGEIIMPQEPSMEDDDFQGGAVNSKYLDDATDVS
EETVISEDAISLTLAKQQYAEELEAEMEDEFNRGLLISKQQYDQLRFEDE
KIVALRNAKDIRELYQLAEEIIMGENYVEAPEECEEEAVVEEPEQDISSD
HEAQEPAKA*

AT30670.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:25:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG46025-PB 209 CG46025-PB 1..209 1..209 1041 100 Plus
CG46025-PA 441 CG46025-PA 233..441 1..209 1041 100 Plus
CG46025-PC 441 CG46025-PC 233..441 1..209 1041 100 Plus
CG46025-PD 596 CG46025-PD 388..596 1..209 1041 100 Plus