Clone AT30770 Report

Search the DGRC for AT30770

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:307
Well:70
Vector:pOTB7
Associated Gene/TranscriptCG30270-RC
Protein status:AT30770.pep: gold
Preliminary Size:2253
Sequenced Size:566

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3612 2002-01-01 Sim4 clustering to Release 2
CG30270 2003-01-01 Sim4 clustering to Release 3
CG30270 2003-01-22 Blastp of sequenced clone
CG30270 2008-04-29 Release 5.5 accounting
CG30270 2008-08-15 Release 5.9 accounting
CG30270 2008-12-18 5.12 accounting

Clone Sequence Records

AT30770.complete Sequence

566 bp (566 high quality bases) assembled on 2003-01-22

GenBank Submission: AY075292

> AT30770.complete
ACACCACAAAATCCAGAATGCAGTTAGCCAAATATTCAATATTTTTGTTC
GTTTTATGCGGAACGCTGATACCGGTAGAAATAGTAGCCAGATCACTGGA
AAAGAAACAGCCGAGAGGATCAGTCGCCAGAACTGTGGAGGGTGAAGCGC
CGGCAGGGGATGCTGCTGCCGCAGGTGCAAAACCGGAACACATTAAGCGT
GACGGAGGAGGAATCCCTGAAATGCCCATGGACCTGCACATGATGCATGC
TCCATGTGACATGGACACCAGGGGTACACAGAGCTATATATTCGCCTTTC
CCAACCATTGCATATGGGCGTTCAACAATCGGTACATGAGCGAAGGACAT
TTCCGCATCTACAAGACCTACCAGTTGGAAGGATTTTTCTTTGGCCAGTA
TTACGAACGACTTAAGCGTTACGAATTCGAGCCACATTCCTACGATTACA
ATATGTAATGCAATGTGCTTAAAGTGCAGCGATCAAATTCTAACTATTTC
GACGGACTACCAAGACATTTCCTTTATAATATAAATATTATTTGTAGCAA
AAAAAAAAAAAAAAAA

AT30770.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:44:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG30270-RC 642 CG30270-RC 91..639 1..549 2745 100 Plus
CG30270-RD 632 CG30270-RD 158..629 78..549 2360 100 Plus
CG30270-RD 632 CG30270-RD 91..159 1..69 345 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 17:34:43
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 18670966..18671446 68..548 2405 100 Plus
chr2R 21145070 chr2R 18670843..18670910 1..68 340 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:03:13 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 17:34:41
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 22784452..22784933 68..549 2410 100 Plus
2R 25286936 2R 22784329..22784396 1..68 340 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:05:27
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 22785651..22786132 68..549 2410 100 Plus
2R 25260384 2R 22785528..22785595 1..68 340 100 Plus
Blast to na_te.dros performed 2019-03-16 17:34:41
Subject Length Description Subject Range Query Range Score Percent Strand
I-element 5371 I-element DMIFACA 5371bp Derived from M14954 (g157749) (Rel. 44, Last updated, Version 2). 744..820 361..279 105 61.4 Minus

AT30770.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 17:35:32 Download gff for AT30770.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 18670843..18670910 1..68 100 -> Plus
chr2R 18670967..18671446 69..548 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:31:14 Download gff for AT30770.complete
Subject Subject Range Query Range Percent Splice Strand
CG30270-RD 1..237 222..458 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:38:46 Download gff for AT30770.complete
Subject Subject Range Query Range Percent Splice Strand
CG30270-RD 1..237 222..458 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:57:57 Download gff for AT30770.complete
Subject Subject Range Query Range Percent Splice Strand
CG30270-RC 1..237 222..458 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:15:38 Download gff for AT30770.complete
Subject Subject Range Query Range Percent Splice Strand
CG30270-RA 1..441 18..458 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:02:25 Download gff for AT30770.complete
Subject Subject Range Query Range Percent Splice Strand
CG30270-RC 1..237 222..458 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:43:16 Download gff for AT30770.complete
Subject Subject Range Query Range Percent Splice Strand
CG30270-RC 26..573 1..548 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:38:46 Download gff for AT30770.complete
Subject Subject Range Query Range Percent Splice Strand
CG30270-RC 26..573 1..548 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:57:57 Download gff for AT30770.complete
Subject Subject Range Query Range Percent Splice Strand
CG30270-RC 26..573 1..548 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:15:38 Download gff for AT30770.complete
Subject Subject Range Query Range Percent Splice Strand
CG30270-RA 31..578 1..548 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:02:25 Download gff for AT30770.complete
Subject Subject Range Query Range Percent Splice Strand
CG30270-RC 26..573 1..548 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:35:32 Download gff for AT30770.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22784329..22784396 1..68 100 -> Plus
2R 22784453..22784932 69..548 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:35:32 Download gff for AT30770.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22784329..22784396 1..68 100 -> Plus
2R 22784453..22784932 69..548 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:35:32 Download gff for AT30770.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22784329..22784396 1..68 100 -> Plus
2R 22784453..22784932 69..548 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:57:57 Download gff for AT30770.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 18671834..18671901 1..68 100 -> Plus
arm_2R 18671958..18672437 69..548 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:51:33 Download gff for AT30770.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22785652..22786131 69..548 100   Plus
2R 22785528..22785595 1..68 100 -> Plus

AT30770.hyp Sequence

Translation from 2 to 457

> AT30770.hyp
TTKSRMQLAKYSIFLFVLCGTLIPVEIVARSLEKKQPRGSVARTVEGEAP
AGDAAAAGAKPEHIKRDGGGIPEMPMDLHMMHAPCDMDTRGTQSYIFAFP
NHCIWAFNNRYMSEGHFRIYKTYQLEGFFFGQYYERLKRYEFEPHSYDYN
M*

AT30770.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:25:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG30270-PD 78 CG30270-PD 1..78 74..151 453 100 Plus
CG30270-PC 78 CG30270-PC 1..78 74..151 453 100 Plus
CG34234-PA 116 CG34234-PA 46..116 72..143 178 44.4 Plus

AT30770.pep Sequence

Translation from 17 to 457

> AT30770.pep
MQLAKYSIFLFVLCGTLIPVEIVARSLEKKQPRGSVARTVEGEAPAGDAA
AAGAKPEHIKRDGGGIPEMPMDLHMMHAPCDMDTRGTQSYIFAFPNHCIW
AFNNRYMSEGHFRIYKTYQLEGFFFGQYYERLKRYEFEPHSYDYNM*

AT30770.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 21:58:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13536-PA 141 GF13536-PA 1..140 1..146 460 53.4 Plus
Dana\GF12449-PA 715 GF12449-PA 638..715 59..138 178 45 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 21:58:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22791-PA 138 GG22791-PA 1..138 1..146 581 72.6 Plus
Dere\GG22575-PA 116 GG22575-PA 51..116 72..138 171 47.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 21:58:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16785-PA 204 GH16785-PA 96..199 37..144 311 50.5 Plus
Dgri\GH24398-PA 152 GH24398-PA 72..147 69..144 305 61.8 Plus
Dgri\GH24409-PA 186 GH24409-PA 92..183 54..145 288 51.1 Plus
Dgri\GH16786-PA 167 GH16786-PA 73..164 54..145 286 51.1 Plus
Dgri\GH19782-PA 64 GH19782-PA 1..62 82..143 164 48.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:27:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG30270-PE 146 CG30270-PE 1..146 1..146 796 100 Plus
CG30270-PF 130 CG30270-PF 5..130 21..146 695 100 Plus
CG30270-PD 78 CG30270-PD 1..78 69..146 453 100 Plus
CG34234-PB 124 CG34234-PB 54..124 67..138 178 44.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 21:58:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13446-PA 169 GI13446-PA 23..165 14..145 314 41.3 Plus
Dmoj\GI20325-PA 142 GI20325-PA 31..142 38..146 235 40.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 21:58:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12051-PA 150 GL12051-PA 28..148 21..143 327 48.8 Plus
Dper\GL11378-PA 120 GL11378-PA 37..114 67..144 266 52.6 Plus
Dper\GL11376-PA 180 GL11376-PA 88..174 57..142 255 47.1 Plus
Dper\GL16817-PA 150 GL16817-PA 27..147 26..142 248 39.7 Plus
Dper\GL11377-PA 200 GL11377-PA 78..196 30..144 244 41.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 21:58:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26175-PA 150 GA26175-PA 28..148 21..143 326 48.8 Plus
Dpse\GA24703-PA 120 GA24703-PA 37..114 67..144 266 52.6 Plus
Dpse\GA24701-PA 180 GA24701-PA 88..176 57..144 252 44.9 Plus
Dpse\GA24702-PA 161 GA24702-PA 71..155 57..142 251 55.2 Plus
Dpse\GA24307-PB 150 GA24307-PB 42..147 29..142 244 43.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 21:58:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15950-PA 146 GM15950-PA 1..146 1..146 655 89.7 Plus
Dsec\GM20357-PA 116 GM20357-PA 16..116 33..138 179 36.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 21:58:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18394-PA 81 GD18394-PA 1..81 66..146 424 93.8 Plus
Dsim\GD11703-PA 78 GD11703-PA 1..78 69..146 411 94.9 Plus
Dsim\GD25836-PA 116 GD25836-PA 16..116 33..138 179 36.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 21:58:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11808-PA 187 GJ11808-PA 105..183 67..145 325 64.6 Plus
Dvir\GJ11807-PA 181 GJ11807-PA 99..176 67..144 320 64.1 Plus
Dvir\GJ22049-PA 153 GJ22049-PA 55..153 49..146 241 45.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 21:58:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19406-PA 111 GK19406-PA 18..108 58..146 327 61.5 Plus
Dwil\GK19394-PA 110 GK19394-PA 2..105 42..145 295 50 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 21:58:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14022-PA 138 GE14022-PA 1..138 1..146 571 72.6 Plus
Dyak\GE13444-PA 116 GE13444-PA 38..116 59..138 179 43.8 Plus