AT30881.complete Sequence
619 bp (619 high quality bases) assembled on 2003-01-22
GenBank Submission: AY075295
> AT30881.complete
GTGACTCGAAATCCGTCAAATTGCACATCTGAAATAATTTTGTTGAAAAA
TAAGAACATTTCCCCAAGGAAACTCTACTGTGGAAACTTGGTGTCGAGGA
TGTCGGACTACTCAAAGTTTCTGTCCAACTTGACGGATCAGCTGGCACTT
CTGCCTAAAGTTGCGCCCAAAGGATTGGGACGATTGGGCAGCCTGGAGAA
CTTGGGCAATAATCTGGGCAATCTGCGCCCCGCCCACAAGGCTCTGATGT
GCGTGGGCGTGGCCACTGTGGCTTGCGTTGTCCTCGGCTTCACTGTTAAG
TCATTAAAGGGACATAGCCGCAAGGACAAGCAAAGGATCATCAATGTACG
AATCGGTAATCCGATCAAGCGGGAACTCGAGGGGGCTGATAAGGACGAAG
GATCCTTTGGGAAGGAAGAAGAACTCAATTGATCAAGAAACCTTAGGGCT
GGGTGATCACAAATATCCCCATCACTATATATTTTGATCTTGTCTTGTGC
GATGCAATGTTGTTATATTTTATAATTTTAGACCGTTAACAAAAACGAAT
TTACAAATGATATTTGTTCCAAATTAAATGAATGCACATTAACATTCAAA
AAAAAAAAAAAAAAAAAAA
AT30881.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 18:24:32
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13021-RA | 900 | CG13021-RA | 1..601 | 1..601 | 3005 | 100 | Plus |
CG13021-RB | 939 | CG13021-RB | 61..640 | 22..601 | 2900 | 100 | Plus |
CG13021-RC | 1137 | CG13021-RC | 328..838 | 91..601 | 2555 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-15 19:25:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chrX | 22417052 | chrX | 3408761..3409267 | 91..597 | 2535 | 100 | Plus |
chrX | 22417052 | chrX | 3407900..3407969 | 22..91 | 350 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:03:18 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 19:24:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 3515251..3515761 | 91..601 | 2555 | 100 | Plus |
X | 23542271 | X | 3514390..3514459 | 22..91 | 350 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:02:14
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23527363 | X | 3523349..3523859 | 91..601 | 2555 | 100 | Plus |
X | 23527363 | X | 3522488..3522557 | 22..91 | 350 | 100 | Plus |
Blast to na_te.dros performed 2019-03-15 19:25:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
diver2 | 4917 | diver2 DIVER2 4917bp | 2652..2709 | 97..151 | 110 | 72.4 | Plus |
AT30881.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 19:25:43 Download gff for
AT30881.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chrX | 3407900..3407969 | 22..91 | 100 | -> | Plus |
chrX | 3407826..3407846 | 1..21 | 100 | -> | Plus |
chrX | 3408762..3409267 | 92..597 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:31:30 Download gff for
AT30881.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13021-RC | 1..333 | 100..432 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:54:59 Download gff for
AT30881.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13021-RC | 1..333 | 100..432 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:50:52 Download gff for
AT30881.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13021-RA | 1..333 | 100..432 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:46:01 Download gff for
AT30881.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13021-RC | 1..333 | 100..432 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:17:46 Download gff for
AT30881.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13021-RA | 1..333 | 100..432 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:10:10 Download gff for
AT30881.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13021-RA | 1..597 | 1..597 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:54:59 Download gff for
AT30881.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13021-RA | 1..597 | 1..597 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:50:52 Download gff for
AT30881.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13021-RA | 1..597 | 1..597 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:46:01 Download gff for
AT30881.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13021-RA | 1..597 | 1..597 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:17:46 Download gff for
AT30881.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13021-RA | 1..597 | 1..597 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:25:43 Download gff for
AT30881.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 3514316..3514336 | 1..21 | 100 | -> | Plus |
X | 3514390..3514459 | 22..91 | 100 | -> | Plus |
X | 3515252..3515757 | 92..597 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:25:43 Download gff for
AT30881.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 3514316..3514336 | 1..21 | 100 | -> | Plus |
X | 3514390..3514459 | 22..91 | 100 | -> | Plus |
X | 3515252..3515757 | 92..597 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:25:43 Download gff for
AT30881.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 3514316..3514336 | 1..21 | 100 | -> | Plus |
X | 3514390..3514459 | 22..91 | 100 | -> | Plus |
X | 3515252..3515757 | 92..597 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:50:52 Download gff for
AT30881.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 3408349..3408369 | 1..21 | 100 | -> | Plus |
arm_X | 3408423..3408492 | 22..91 | 100 | -> | Plus |
arm_X | 3409285..3409790 | 92..597 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:17:05 Download gff for
AT30881.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 3523350..3523855 | 92..597 | 100 | | Plus |
X | 3522414..3522434 | 1..21 | 100 | -> | Plus |
X | 3522488..3522557 | 22..91 | 100 | -> | Plus |
AT30881.hyp Sequence
Translation from 1 to 431
> AT30881.hyp
VTRNPSNCTSEIILLKNKNISPRKLYCGNLVSRMSDYSKFLSNLTDQLAL
LPKVAPKGLGRLGSLENLGNNLGNLRPAHKALMCVGVATVACVVLGFTVK
SLKGHSRKDKQRIINVRIGNPIKRELEGADKDEGSFGKEEELN*
AT30881.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:25:43
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13021-PB | 110 | CG13021-PB | 1..110 | 34..143 | 560 | 100 | Plus |
CG13021-PA | 110 | CG13021-PA | 1..110 | 34..143 | 560 | 100 | Plus |
AT30881.pep Sequence
Translation from 99 to 431
> AT30881.pep
MSDYSKFLSNLTDQLALLPKVAPKGLGRLGSLENLGNNLGNLRPAHKALM
CVGVATVACVVLGFTVKSLKGHSRKDKQRIINVRIGNPIKRELEGADKDE
GSFGKEEELN*
AT30881.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:25:03
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF22640-PA | 116 | GF22640-PA | 1..52 | 1..69 | 136 | 44.9 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:25:04
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG18659-PA | 114 | GG18659-PA | 1..114 | 1..110 | 390 | 71.1 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:41:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13021-PB | 110 | CG13021-PB | 1..110 | 1..110 | 560 | 100 | Plus |
CG13021-PA | 110 | CG13021-PA | 1..110 | 1..110 | 560 | 100 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:25:06
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM12296-PA | 110 | GM12296-PA | 1..109 | 1..109 | 407 | 88.1 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:25:06
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD16645-PA | 110 | GD16645-PA | 1..109 | 1..109 | 422 | 89.9 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:25:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE16303-PA | 104 | GE16303-PA | 1..103 | 1..109 | 373 | 71.6 | Plus |