Clone AT30881 Report

Search the DGRC for AT30881

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:308
Well:81
Vector:pOTB7
Associated Gene/TranscriptCG13021-RA
Protein status:AT30881.pep: gold
Preliminary Size:333
Sequenced Size:619

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13021 2002-01-01 Sim4 clustering to Release 2
CG13021 2003-01-01 Sim4 clustering to Release 3
CG13021 2003-01-22 Blastp of sequenced clone
CG13021 2008-04-29 Release 5.5 accounting
CG13021 2008-08-15 Release 5.9 accounting
CG13021 2008-12-18 5.12 accounting

Clone Sequence Records

AT30881.complete Sequence

619 bp (619 high quality bases) assembled on 2003-01-22

GenBank Submission: AY075295

> AT30881.complete
GTGACTCGAAATCCGTCAAATTGCACATCTGAAATAATTTTGTTGAAAAA
TAAGAACATTTCCCCAAGGAAACTCTACTGTGGAAACTTGGTGTCGAGGA
TGTCGGACTACTCAAAGTTTCTGTCCAACTTGACGGATCAGCTGGCACTT
CTGCCTAAAGTTGCGCCCAAAGGATTGGGACGATTGGGCAGCCTGGAGAA
CTTGGGCAATAATCTGGGCAATCTGCGCCCCGCCCACAAGGCTCTGATGT
GCGTGGGCGTGGCCACTGTGGCTTGCGTTGTCCTCGGCTTCACTGTTAAG
TCATTAAAGGGACATAGCCGCAAGGACAAGCAAAGGATCATCAATGTACG
AATCGGTAATCCGATCAAGCGGGAACTCGAGGGGGCTGATAAGGACGAAG
GATCCTTTGGGAAGGAAGAAGAACTCAATTGATCAAGAAACCTTAGGGCT
GGGTGATCACAAATATCCCCATCACTATATATTTTGATCTTGTCTTGTGC
GATGCAATGTTGTTATATTTTATAATTTTAGACCGTTAACAAAAACGAAT
TTACAAATGATATTTGTTCCAAATTAAATGAATGCACATTAACATTCAAA
AAAAAAAAAAAAAAAAAAA

AT30881.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:24:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG13021-RA 900 CG13021-RA 1..601 1..601 3005 100 Plus
CG13021-RB 939 CG13021-RB 61..640 22..601 2900 100 Plus
CG13021-RC 1137 CG13021-RC 328..838 91..601 2555 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 19:25:01
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 3408761..3409267 91..597 2535 100 Plus
chrX 22417052 chrX 3407900..3407969 22..91 350 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:03:18 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 19:24:59
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 3515251..3515761 91..601 2555 100 Plus
X 23542271 X 3514390..3514459 22..91 350 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:02:14
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 3523349..3523859 91..601 2555 100 Plus
X 23527363 X 3522488..3522557 22..91 350 100 Plus
Blast to na_te.dros performed 2019-03-15 19:25:00
Subject Length Description Subject Range Query Range Score Percent Strand
diver2 4917 diver2 DIVER2 4917bp 2652..2709 97..151 110 72.4 Plus

AT30881.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 19:25:43 Download gff for AT30881.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 3407900..3407969 22..91 100 -> Plus
chrX 3407826..3407846 1..21 100 -> Plus
chrX 3408762..3409267 92..597 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:31:30 Download gff for AT30881.complete
Subject Subject Range Query Range Percent Splice Strand
CG13021-RC 1..333 100..432 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:54:59 Download gff for AT30881.complete
Subject Subject Range Query Range Percent Splice Strand
CG13021-RC 1..333 100..432 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:50:52 Download gff for AT30881.complete
Subject Subject Range Query Range Percent Splice Strand
CG13021-RA 1..333 100..432 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:46:01 Download gff for AT30881.complete
Subject Subject Range Query Range Percent Splice Strand
CG13021-RC 1..333 100..432 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:17:46 Download gff for AT30881.complete
Subject Subject Range Query Range Percent Splice Strand
CG13021-RA 1..333 100..432 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:10:10 Download gff for AT30881.complete
Subject Subject Range Query Range Percent Splice Strand
CG13021-RA 1..597 1..597 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:54:59 Download gff for AT30881.complete
Subject Subject Range Query Range Percent Splice Strand
CG13021-RA 1..597 1..597 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:50:52 Download gff for AT30881.complete
Subject Subject Range Query Range Percent Splice Strand
CG13021-RA 1..597 1..597 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:46:01 Download gff for AT30881.complete
Subject Subject Range Query Range Percent Splice Strand
CG13021-RA 1..597 1..597 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:17:46 Download gff for AT30881.complete
Subject Subject Range Query Range Percent Splice Strand
CG13021-RA 1..597 1..597 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:25:43 Download gff for AT30881.complete
Subject Subject Range Query Range Percent Splice Strand
X 3514316..3514336 1..21 100 -> Plus
X 3514390..3514459 22..91 100 -> Plus
X 3515252..3515757 92..597 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:25:43 Download gff for AT30881.complete
Subject Subject Range Query Range Percent Splice Strand
X 3514316..3514336 1..21 100 -> Plus
X 3514390..3514459 22..91 100 -> Plus
X 3515252..3515757 92..597 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:25:43 Download gff for AT30881.complete
Subject Subject Range Query Range Percent Splice Strand
X 3514316..3514336 1..21 100 -> Plus
X 3514390..3514459 22..91 100 -> Plus
X 3515252..3515757 92..597 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:50:52 Download gff for AT30881.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 3408349..3408369 1..21 100 -> Plus
arm_X 3408423..3408492 22..91 100 -> Plus
arm_X 3409285..3409790 92..597 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:17:05 Download gff for AT30881.complete
Subject Subject Range Query Range Percent Splice Strand
X 3523350..3523855 92..597 100   Plus
X 3522414..3522434 1..21 100 -> Plus
X 3522488..3522557 22..91 100 -> Plus

AT30881.hyp Sequence

Translation from 1 to 431

> AT30881.hyp
VTRNPSNCTSEIILLKNKNISPRKLYCGNLVSRMSDYSKFLSNLTDQLAL
LPKVAPKGLGRLGSLENLGNNLGNLRPAHKALMCVGVATVACVVLGFTVK
SLKGHSRKDKQRIINVRIGNPIKRELEGADKDEGSFGKEEELN*

AT30881.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:25:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG13021-PB 110 CG13021-PB 1..110 34..143 560 100 Plus
CG13021-PA 110 CG13021-PA 1..110 34..143 560 100 Plus

AT30881.pep Sequence

Translation from 99 to 431

> AT30881.pep
MSDYSKFLSNLTDQLALLPKVAPKGLGRLGSLENLGNNLGNLRPAHKALM
CVGVATVACVVLGFTVKSLKGHSRKDKQRIINVRIGNPIKRELEGADKDE
GSFGKEEELN*

AT30881.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:25:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22640-PA 116 GF22640-PA 1..52 1..69 136 44.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:25:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18659-PA 114 GG18659-PA 1..114 1..110 390 71.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:41:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG13021-PB 110 CG13021-PB 1..110 1..110 560 100 Plus
CG13021-PA 110 CG13021-PA 1..110 1..110 560 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:25:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12296-PA 110 GM12296-PA 1..109 1..109 407 88.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:25:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16645-PA 110 GD16645-PA 1..109 1..109 422 89.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:25:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16303-PA 104 GE16303-PA 1..103 1..109 373 71.6 Plus