Clone AT30929 Report

Search the DGRC for AT30929

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:309
Well:29
Vector:pOTB7
Associated Gene/TranscriptCG30192-RA
Protein status:AT30929.pep: gold
Sequenced Size:391

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12192 2002-01-01 Sim4 clustering to Release 2
CG30192 2003-01-01 Sim4 clustering to Release 3
CG30192 2003-01-22 Blastp of sequenced clone
CG30192 2008-04-29 Release 5.5 accounting
CG30192 2008-08-15 Release 5.9 accounting
CG30192 2008-12-18 5.12 accounting

Clone Sequence Records

AT30929.complete Sequence

391 bp (391 high quality bases) assembled on 2003-01-22

GenBank Submission: AY075296

> AT30929.complete
CCAAATCAAAGCTGCCGTAAACACTTTGAAGTGTGATTAAAATTTAAATC
CAAATTGTGAGTTTTCATATAAATTTCTACTTCACCATGGCGGATCCGAG
TATCAATGACATCGATGAGACTGTGGCTCCTCCCCTCGGAGGCGCTGACA
GCTTCGACCTGAACAAGCGGCTAGATTGCGAGCATTTAGATCAGATGACG
GATAATTGGACCGATTATCAAAGACCCTCGTTTGCCACCGAACTTCTGCG
ATTTTTCGGCAACGTATTTGTCGATATATTTAATGCGATTTTCAACTGAT
CTAATCCGTATACTTGTAACTGTTGCAGAGCAGTCAATGGTTCCATAGCA
AAACTAATAAAATCTTTAGTTAGAAAAAAAAAAAAAAAAAA

AT30929.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:24:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG30192-RA 434 CG30192-RA 58..434 1..377 1870 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 09:31:12
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 19025029..19025217 1..189 870 97.4 Plus
chr2R 21145070 chr2R 19025422..19025525 270..373 505 99 Plus
chr2R 21145070 chr2R 19025282..19025364 188..270 415 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:03:19 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 09:31:10
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 23138589..23138777 1..189 930 99.5 Plus
2R 25286936 2R 23138982..23139089 270..377 540 100 Plus
2R 25286936 2R 23138842..23138924 188..270 415 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:02:15
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 23139788..23139976 1..189 930 99.4 Plus
2R 25260384 2R 23140181..23140288 270..377 540 100 Plus
2R 25260384 2R 23140041..23140123 188..270 415 100 Plus
Blast to na_te.dros performed 2019-03-16 09:31:10
Subject Length Description Subject Range Query Range Score Percent Strand
3S18 6126 3S18 DM23420 6126bp Derived from U23420 (g733531) (Rel. 48, Last updated, Version 3). 3970..4004 221..255 112 80 Plus

AT30929.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 09:32:22 Download gff for AT30929.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 19025029..19025217 1..189 97 -> Plus
chr2R 19025284..19025364 190..270 100 -> Plus
chr2R 19025423..19025525 271..373 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:31:33 Download gff for AT30929.complete
Subject Subject Range Query Range Percent Splice Strand
CG30192-RA 1..213 87..299 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:55:01 Download gff for AT30929.complete
Subject Subject Range Query Range Percent Splice Strand
CG30192-RA 1..213 87..299 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:50:12 Download gff for AT30929.complete
Subject Subject Range Query Range Percent Splice Strand
CG30192-RA 1..213 87..299 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:46:04 Download gff for AT30929.complete
Subject Subject Range Query Range Percent Splice Strand
CG30192-RA 1..213 87..299 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:12:16 Download gff for AT30929.complete
Subject Subject Range Query Range Percent Splice Strand
CG30192-RA 1..213 87..299 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:10:11 Download gff for AT30929.complete
Subject Subject Range Query Range Percent Splice Strand
CG30192-RA 10..382 1..373 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:55:01 Download gff for AT30929.complete
Subject Subject Range Query Range Percent Splice Strand
CG30192-RA 10..382 1..373 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:50:12 Download gff for AT30929.complete
Subject Subject Range Query Range Percent Splice Strand
CG30192-RA 1..373 1..373 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:46:04 Download gff for AT30929.complete
Subject Subject Range Query Range Percent Splice Strand
CG30192-RA 10..382 1..373 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:12:16 Download gff for AT30929.complete
Subject Subject Range Query Range Percent Splice Strand
CG30192-RA 1..373 1..373 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:32:22 Download gff for AT30929.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23138589..23138777 1..189 99 -> Plus
2R 23138844..23138924 190..270 100 -> Plus
2R 23138983..23139085 271..373 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:32:22 Download gff for AT30929.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23138589..23138777 1..189 99 -> Plus
2R 23138844..23138924 190..270 100 -> Plus
2R 23138983..23139085 271..373 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:32:22 Download gff for AT30929.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23138589..23138777 1..189 99 -> Plus
2R 23138844..23138924 190..270 100 -> Plus
2R 23138983..23139085 271..373 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:50:12 Download gff for AT30929.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19026112..19026300 1..189 99 -> Plus
arm_2R 19026367..19026447 190..270 100 -> Plus
arm_2R 19026506..19026608 271..373 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:17:06 Download gff for AT30929.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23139806..23139994 1..189 99 -> Plus
2R 23140061..23140141 190..270 100 -> Plus
2R 23140200..23140302 271..373 100   Plus

AT30929.hyp Sequence

Translation from 86 to 298

> AT30929.hyp
MADPSINDIDETVAPPLGGADSFDLNKRLDCEHLDQMTDNWTDYQRPSFA
TELLRFFGNVFVDIFNAIFN*

AT30929.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:25:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG30192-PA 70 CG30192-PA 1..70 1..70 378 100 Plus

AT30929.pep Sequence

Translation from 86 to 298

> AT30929.pep
MADPSINDIDETVAPPLGGADSFDLNKRLDCEHLDQMTDNWTDYQRPSFA
TELLRFFGNVFVDIFNAIFN*

AT30929.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:07:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11560-PA 72 GF11560-PA 1..72 1..70 184 53.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:07:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22830-PA 70 GG22830-PA 1..69 1..69 297 81.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:07:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22722-PA 66 GH22722-PA 8..65 11..69 166 55.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:26:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG30192-PA 70 CG30192-PA 1..70 1..70 378 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:07:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18508-PA 66 GI18508-PA 8..65 12..69 144 52.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:07:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10780-PA 70 GL10780-PA 1..69 1..69 193 55.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:07:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15717-PA 70 GA15717-PA 1..69 1..69 193 55.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:07:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15988-PA 70 GM15988-PA 1..70 1..70 341 91.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:07:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11741-PA 70 GD11741-PA 1..70 1..70 345 92.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:07:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21371-PA 64 GJ21371-PA 4..63 11..69 185 61.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:07:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19552-PA 72 GK19552-PA 1..72 1..70 201 54.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:07:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14265-PA 67 GE14265-PA 1..66 1..69 270 76.8 Plus