BDGP Sequence Production Resources |
Search the DGRC for AT30929
Library: | AT |
Tissue Source: | Drosophila melanogaster adult testes |
Created by: | Ling Hong |
Date Registered: | 2000-06-08 |
Comments: | Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7 |
Original Plate Number: | 309 |
Well: | 29 |
Vector: | pOTB7 |
Associated Gene/Transcript | CG30192-RA |
Protein status: | AT30929.pep: gold |
Sequenced Size: | 391 |
Gene | Date | Evidence |
---|---|---|
CG12192 | 2002-01-01 | Sim4 clustering to Release 2 |
CG30192 | 2003-01-01 | Sim4 clustering to Release 3 |
CG30192 | 2003-01-22 | Blastp of sequenced clone |
CG30192 | 2008-04-29 | Release 5.5 accounting |
CG30192 | 2008-08-15 | Release 5.9 accounting |
CG30192 | 2008-12-18 | 5.12 accounting |
391 bp (391 high quality bases) assembled on 2003-01-22
GenBank Submission: AY075296
> AT30929.complete CCAAATCAAAGCTGCCGTAAACACTTTGAAGTGTGATTAAAATTTAAATC CAAATTGTGAGTTTTCATATAAATTTCTACTTCACCATGGCGGATCCGAG TATCAATGACATCGATGAGACTGTGGCTCCTCCCCTCGGAGGCGCTGACA GCTTCGACCTGAACAAGCGGCTAGATTGCGAGCATTTAGATCAGATGACG GATAATTGGACCGATTATCAAAGACCCTCGTTTGCCACCGAACTTCTGCG ATTTTTCGGCAACGTATTTGTCGATATATTTAATGCGATTTTCAACTGAT CTAATCCGTATACTTGTAACTGTTGCAGAGCAGTCAATGGTTCCATAGCA AAACTAATAAAATCTTTAGTTAGAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG30192-RA | 434 | CG30192-RA | 58..434 | 1..377 | 1870 | 99.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 19025029..19025217 | 1..189 | 870 | 97.4 | Plus |
chr2R | 21145070 | chr2R | 19025422..19025525 | 270..373 | 505 | 99 | Plus |
chr2R | 21145070 | chr2R | 19025282..19025364 | 188..270 | 415 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25286936 | 2R | 23138589..23138777 | 1..189 | 930 | 99.5 | Plus |
2R | 25286936 | 2R | 23138982..23139089 | 270..377 | 540 | 100 | Plus |
2R | 25286936 | 2R | 23138842..23138924 | 188..270 | 415 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25260384 | 2R | 23139788..23139976 | 1..189 | 930 | 99.4 | Plus |
2R | 25260384 | 2R | 23140181..23140288 | 270..377 | 540 | 100 | Plus |
2R | 25260384 | 2R | 23140041..23140123 | 188..270 | 415 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3S18 | 6126 | 3S18 DM23420 6126bp Derived from U23420 (g733531) (Rel. 48, Last updated, Version 3). | 3970..4004 | 221..255 | 112 | 80 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 19025029..19025217 | 1..189 | 97 | -> | Plus |
chr2R | 19025284..19025364 | 190..270 | 100 | -> | Plus |
chr2R | 19025423..19025525 | 271..373 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30192-RA | 1..213 | 87..299 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30192-RA | 1..213 | 87..299 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30192-RA | 1..213 | 87..299 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30192-RA | 1..213 | 87..299 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30192-RA | 1..213 | 87..299 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30192-RA | 10..382 | 1..373 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30192-RA | 10..382 | 1..373 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30192-RA | 1..373 | 1..373 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30192-RA | 10..382 | 1..373 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30192-RA | 1..373 | 1..373 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 23138589..23138777 | 1..189 | 99 | -> | Plus |
2R | 23138844..23138924 | 190..270 | 100 | -> | Plus |
2R | 23138983..23139085 | 271..373 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 23138589..23138777 | 1..189 | 99 | -> | Plus |
2R | 23138844..23138924 | 190..270 | 100 | -> | Plus |
2R | 23138983..23139085 | 271..373 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 23138589..23138777 | 1..189 | 99 | -> | Plus |
2R | 23138844..23138924 | 190..270 | 100 | -> | Plus |
2R | 23138983..23139085 | 271..373 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 19026112..19026300 | 1..189 | 99 | -> | Plus |
arm_2R | 19026367..19026447 | 190..270 | 100 | -> | Plus |
arm_2R | 19026506..19026608 | 271..373 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 23139806..23139994 | 1..189 | 99 | -> | Plus |
2R | 23140061..23140141 | 190..270 | 100 | -> | Plus |
2R | 23140200..23140302 | 271..373 | 100 | Plus |
Translation from 86 to 298
> AT30929.hyp MADPSINDIDETVAPPLGGADSFDLNKRLDCEHLDQMTDNWTDYQRPSFA TELLRFFGNVFVDIFNAIFN*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG30192-PA | 70 | CG30192-PA | 1..70 | 1..70 | 378 | 100 | Plus |
Translation from 86 to 298
> AT30929.pep MADPSINDIDETVAPPLGGADSFDLNKRLDCEHLDQMTDNWTDYQRPSFA TELLRFFGNVFVDIFNAIFN*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF11560-PA | 72 | GF11560-PA | 1..72 | 1..70 | 184 | 53.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG22830-PA | 70 | GG22830-PA | 1..69 | 1..69 | 297 | 81.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH22722-PA | 66 | GH22722-PA | 8..65 | 11..69 | 166 | 55.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG30192-PA | 70 | CG30192-PA | 1..70 | 1..70 | 378 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI18508-PA | 66 | GI18508-PA | 8..65 | 12..69 | 144 | 52.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL10780-PA | 70 | GL10780-PA | 1..69 | 1..69 | 193 | 55.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA15717-PA | 70 | GA15717-PA | 1..69 | 1..69 | 193 | 55.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM15988-PA | 70 | GM15988-PA | 1..70 | 1..70 | 341 | 91.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD11741-PA | 70 | GD11741-PA | 1..70 | 1..70 | 345 | 92.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ21371-PA | 64 | GJ21371-PA | 4..63 | 11..69 | 185 | 61.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK19552-PA | 72 | GK19552-PA | 1..72 | 1..70 | 201 | 54.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE14265-PA | 67 | GE14265-PA | 1..66 | 1..69 | 270 | 76.8 | Plus |