Clone AT30947 Report

Search the DGRC for AT30947

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:309
Well:47
Vector:pOTB7
Associated Gene/TranscriptI-3-RB
Protein status:AT30947.pep: gold
Sequenced Size:800

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11233 2003-01-01 Sim4 clustering to Release 3
CG11233 2004-01-31 Blastp of sequenced clone
l(1)19Ec 2008-04-29 Release 5.5 accounting
l(1)19Ec 2008-04-29 Picked prior to 5.5
l(1)19Ec 2008-08-15 Release 5.9 accounting
l(1)19Ec 2008-12-18 5.12 accounting

Clone Sequence Records

AT30947.complete Sequence

800 bp (800 high quality bases) assembled on 2004-01-31

GenBank Submission: BT011553

> AT30947.complete
TTTTTCTTTTTATACATCCAAATTTCTAAGCGTATATTTCTGATTTTGTT
AATATGGATTCGAATTGCGATTTATCGATGGTCAATGGTCAAACGGAGCC
CAAAGACCCAAAATGGGCGTCGTCGTCAACCCAGATAACTTCTCGGGCAT
CGGAAACCTTTTCCGGAGTTGGCTCGGCGATAAGCACTGAAACGTCCTTG
CAGCCAGTGGCCGCGCCCACGATGTACTGCCTCCGATTGGCGCAGCAGAG
GCCGATAACCGAACGGCACGTCCACTTTCATGCCGGCGTTATCGATAACG
AGCACATGAACCGGCGCAAATCGAAATGCTGCTGCATCTATCGAAAGCCA
CATCCTTTCGGCGAGAGTTCGTCCTCCACGGACGACGAGTGCGAACACTG
CTTTGGTCATCCCGAAGTGAGAACTCGCAATCGGTTGGAAAAACAGCGGA
TACAGGAACAGCAAAACGGGTGCAGTTGCTGTCATCATCACCATCGACTT
CATAGTAATCGGAATAATCGACCGCCTACCGAAGAGATCGCGCAGCATAA
GGATGATCTGGCCAAAGAGGAACCAAAATCGGTAGTCAACAATGAAAGTA
GTCTAAAACTTTTAAACGAGGAAAATGTAAAATCATCTAAACCAGAAAAA
AAAAATAATTCAAATAACCGCCTCGAAGTAACTTTTGTAGAGCTTGATTA
AAATTGGAATTTTGCAAGTTTAAGTACCCGATACTCGTGTTGAATTAGTA
ACCAAGAATAAAAAAAAACTGTATAACTTGTAAAAAAAAAAAAAAAAAAA

AT30947.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:06:00
Subject Length Description Subject Range Query Range Score Percent Strand
l(1)19Ec-RB 813 l(1)19Ec-RB 32..813 1..781 3840 99.6 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 05:56:47
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 20747142..20747916 781..7 3860 99.9 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:03:20 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 05:56:45
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 20881811..20882588 784..7 3845 99.6 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:52:42
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 20866903..20867687 784..1 3855 99.6 Minus
Blast to na_te.dros performed 2019-03-16 05:56:46
Subject Length Description Subject Range Query Range Score Percent Strand
mdg1 7480 mdg1 DMRTMGD1 7480bp Derived from X59545 (g8507) (Rel. 49, Last updated, Version 4). 1203..1249 619..668 107 74 Plus

AT30947.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 05:57:29 Download gff for AT30947.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 20747142..20747911 12..781 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:31:35 Download gff for AT30947.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)19Ec-RB 1..648 54..701 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:40:51 Download gff for AT30947.complete
Subject Subject Range Query Range Percent Splice Strand
CG42707-RB 1..648 54..701 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:03:40 Download gff for AT30947.complete
Subject Subject Range Query Range Percent Splice Strand
I-3-RB 1..648 54..701 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:29:43 Download gff for AT30947.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)19Ec-RB 1..648 54..701 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:10:09 Download gff for AT30947.complete
Subject Subject Range Query Range Percent Splice Strand
I-3-RB 1..648 54..701 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:49:58 Download gff for AT30947.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)19Ec-RB 44..813 12..781 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:40:51 Download gff for AT30947.complete
Subject Subject Range Query Range Percent Splice Strand
CG42707-RB 44..813 12..781 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:03:40 Download gff for AT30947.complete
Subject Subject Range Query Range Percent Splice Strand
I-3-RB 44..813 12..781 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:29:43 Download gff for AT30947.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)19Ec-RB 44..813 12..781 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:10:09 Download gff for AT30947.complete
Subject Subject Range Query Range Percent Splice Strand
I-3-RB 44..813 12..781 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:57:29 Download gff for AT30947.complete
Subject Subject Range Query Range Percent Splice Strand
X 20881814..20882583 12..781 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:57:29 Download gff for AT30947.complete
Subject Subject Range Query Range Percent Splice Strand
X 20881814..20882583 12..781 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:57:29 Download gff for AT30947.complete
Subject Subject Range Query Range Percent Splice Strand
X 20881814..20882583 12..781 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:03:40 Download gff for AT30947.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 20752841..20753610 12..781 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:02:07 Download gff for AT30947.complete
Subject Subject Range Query Range Percent Splice Strand
X 20866906..20867675 12..781 99   Minus

AT30947.hyp Sequence

Translation from 53 to 700

> AT30947.hyp
MDSNCDLSMVNGQTEPKDPKWASSSTQITSRASETFSGVGSAISTETSLQ
PVAAPTMYCLRLAQQRPITERHVHFHAGVIDNEHMNRRKSKCCCIYRKPH
PFGESSSSTDDECEHCFGHPEVRTRNRLEKQRIQEQQNGCSCCHHHHRLH
SNRNNRPPTEEIAQHKDDLAKEEPKSVVNNESSLKLLNEENVKSSKPEKK
NNSNNRLEVTFVELD*

AT30947.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:25:45
Subject Length Description Subject Range Query Range Score Percent Strand
I-3-PB 215 CG11233-PB 1..215 1..215 1163 100 Plus
CG13994-PB 163 CG13994-PB 6..147 30..167 278 43.1 Plus
CG13994-PA 163 CG13994-PA 6..147 30..167 278 43.1 Plus

AT30947.pep Sequence

Translation from 53 to 700

> AT30947.pep
MDSNCDLSMVNGQTEPKDPKWASSSTQITSRASETFSGVGSAISTETSLQ
PVAAPTMYCLRLAQQRPITERHVHFHAGVIDNEHMNRRKSKCCCIYRKPH
PFGESSSSTDDECEHCFGHPEVRTRNRLEKQRIQEQQNGCSCCHHHHRLH
SNRNNRPPTEEIAQHKDDLAKEEPKSVVNNESSLKLLNEENVKSSKPEKK
NNSNNRLEVTFVELD*

AT30947.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:37:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21704-PA 274 GF21704-PA 132..207 71..143 333 78.9 Plus
Dana\GF14499-PA 163 GF14499-PA 12..102 23..126 256 52.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:37:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17569-PA 193 GG17569-PA 5..180 4..176 638 73.9 Plus
Dere\GG23925-PA 161 GG23925-PA 29..102 53..126 261 66.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:37:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10799-PA 150 GH10799-PA 25..93 50..121 251 68.1 Plus
Dgri\GH17766-PA 169 GH17766-PA 53..113 71..131 223 80.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:36:24
Subject Length Description Subject Range Query Range Score Percent Strand
I-3-PB 215 CG11233-PB 1..215 1..215 1163 100 Plus
CG13994-PB 163 CG13994-PB 6..147 30..167 278 43.1 Plus
CG13994-PA 163 CG13994-PA 6..147 30..167 278 43.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:37:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17309-PA 159 GI17309-PA 16..105 33..127 283 63.2 Plus
Dmoj\GI15102-PA 170 GI15102-PA 4..161 15..178 252 42.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:37:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19060-PA 156 GL19060-PA 12..95 40..126 265 60.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:37:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10854-PA 217 GA10854-PA 105..165 71..131 298 83.6 Plus
Dpse\GA12683-PA 156 GA12683-PA 12..95 40..126 265 60.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:37:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22654-PA 139 GM22654-PA 1..139 1..139 638 84.9 Plus
Dsec\GM18598-PA 163 GM18598-PA 6..104 30..126 271 55.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:37:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24438-PA 180 GD24438-PA 1..179 1..179 836 86.6 Plus
Dsim\GD23382-PA 163 GD23382-PA 6..104 30..126 271 55.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:37:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15772-PA 151 GJ15772-PA 15..100 33..127 273 61.1 Plus
Dvir\GJ18910-PA 212 GJ18910-PA 15..118 25..130 258 58.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:37:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14722-PA 162 GK14722-PA 27..96 54..126 274 72.6 Plus
Dwil\GK20046-PA 149 GK20046-PA 67..146 60..143 231 64.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:37:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15329-PA 184 GE15329-PA 1..184 1..192 631 71.6 Plus
Dyak\GE25877-PA 161 GE25877-PA 8..102 34..126 264 56.8 Plus