BDGP Sequence Production Resources |
Search the DGRC for AT30947
Library: | AT |
Tissue Source: | Drosophila melanogaster adult testes |
Created by: | Ling Hong |
Date Registered: | 2000-06-08 |
Comments: | Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7 |
Original Plate Number: | 309 |
Well: | 47 |
Vector: | pOTB7 |
Associated Gene/Transcript | I-3-RB |
Protein status: | AT30947.pep: gold |
Sequenced Size: | 800 |
Gene | Date | Evidence |
---|---|---|
CG11233 | 2003-01-01 | Sim4 clustering to Release 3 |
CG11233 | 2004-01-31 | Blastp of sequenced clone |
l(1)19Ec | 2008-04-29 | Release 5.5 accounting |
l(1)19Ec | 2008-04-29 | Picked prior to 5.5 |
l(1)19Ec | 2008-08-15 | Release 5.9 accounting |
l(1)19Ec | 2008-12-18 | 5.12 accounting |
800 bp (800 high quality bases) assembled on 2004-01-31
GenBank Submission: BT011553
> AT30947.complete TTTTTCTTTTTATACATCCAAATTTCTAAGCGTATATTTCTGATTTTGTT AATATGGATTCGAATTGCGATTTATCGATGGTCAATGGTCAAACGGAGCC CAAAGACCCAAAATGGGCGTCGTCGTCAACCCAGATAACTTCTCGGGCAT CGGAAACCTTTTCCGGAGTTGGCTCGGCGATAAGCACTGAAACGTCCTTG CAGCCAGTGGCCGCGCCCACGATGTACTGCCTCCGATTGGCGCAGCAGAG GCCGATAACCGAACGGCACGTCCACTTTCATGCCGGCGTTATCGATAACG AGCACATGAACCGGCGCAAATCGAAATGCTGCTGCATCTATCGAAAGCCA CATCCTTTCGGCGAGAGTTCGTCCTCCACGGACGACGAGTGCGAACACTG CTTTGGTCATCCCGAAGTGAGAACTCGCAATCGGTTGGAAAAACAGCGGA TACAGGAACAGCAAAACGGGTGCAGTTGCTGTCATCATCACCATCGACTT CATAGTAATCGGAATAATCGACCGCCTACCGAAGAGATCGCGCAGCATAA GGATGATCTGGCCAAAGAGGAACCAAAATCGGTAGTCAACAATGAAAGTA GTCTAAAACTTTTAAACGAGGAAAATGTAAAATCATCTAAACCAGAAAAA AAAAATAATTCAAATAACCGCCTCGAAGTAACTTTTGTAGAGCTTGATTA AAATTGGAATTTTGCAAGTTTAAGTACCCGATACTCGTGTTGAATTAGTA ACCAAGAATAAAAAAAAACTGTATAACTTGTAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
l(1)19Ec-RB | 813 | l(1)19Ec-RB | 32..813 | 1..781 | 3840 | 99.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chrX | 22417052 | chrX | 20747142..20747916 | 781..7 | 3860 | 99.9 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
X | 23542271 | X | 20881811..20882588 | 784..7 | 3845 | 99.6 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
X | 23527363 | X | 20866903..20867687 | 784..1 | 3855 | 99.6 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
mdg1 | 7480 | mdg1 DMRTMGD1 7480bp Derived from X59545 (g8507) (Rel. 49, Last updated, Version 4). | 1203..1249 | 619..668 | 107 | 74 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chrX | 20747142..20747911 | 12..781 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
l(1)19Ec-RB | 1..648 | 54..701 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG42707-RB | 1..648 | 54..701 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
I-3-RB | 1..648 | 54..701 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
l(1)19Ec-RB | 1..648 | 54..701 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
I-3-RB | 1..648 | 54..701 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
l(1)19Ec-RB | 44..813 | 12..781 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG42707-RB | 44..813 | 12..781 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
I-3-RB | 44..813 | 12..781 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
l(1)19Ec-RB | 44..813 | 12..781 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
I-3-RB | 44..813 | 12..781 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 20881814..20882583 | 12..781 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 20881814..20882583 | 12..781 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 20881814..20882583 | 12..781 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_X | 20752841..20753610 | 12..781 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 20866906..20867675 | 12..781 | 99 | Minus |
Translation from 53 to 700
> AT30947.hyp MDSNCDLSMVNGQTEPKDPKWASSSTQITSRASETFSGVGSAISTETSLQ PVAAPTMYCLRLAQQRPITERHVHFHAGVIDNEHMNRRKSKCCCIYRKPH PFGESSSSTDDECEHCFGHPEVRTRNRLEKQRIQEQQNGCSCCHHHHRLH SNRNNRPPTEEIAQHKDDLAKEEPKSVVNNESSLKLLNEENVKSSKPEKK NNSNNRLEVTFVELD*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
I-3-PB | 215 | CG11233-PB | 1..215 | 1..215 | 1163 | 100 | Plus |
CG13994-PB | 163 | CG13994-PB | 6..147 | 30..167 | 278 | 43.1 | Plus |
CG13994-PA | 163 | CG13994-PA | 6..147 | 30..167 | 278 | 43.1 | Plus |
Translation from 53 to 700
> AT30947.pep MDSNCDLSMVNGQTEPKDPKWASSSTQITSRASETFSGVGSAISTETSLQ PVAAPTMYCLRLAQQRPITERHVHFHAGVIDNEHMNRRKSKCCCIYRKPH PFGESSSSTDDECEHCFGHPEVRTRNRLEKQRIQEQQNGCSCCHHHHRLH SNRNNRPPTEEIAQHKDDLAKEEPKSVVNNESSLKLLNEENVKSSKPEKK NNSNNRLEVTFVELD*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF21704-PA | 274 | GF21704-PA | 132..207 | 71..143 | 333 | 78.9 | Plus |
Dana\GF14499-PA | 163 | GF14499-PA | 12..102 | 23..126 | 256 | 52.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG17569-PA | 193 | GG17569-PA | 5..180 | 4..176 | 638 | 73.9 | Plus |
Dere\GG23925-PA | 161 | GG23925-PA | 29..102 | 53..126 | 261 | 66.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH10799-PA | 150 | GH10799-PA | 25..93 | 50..121 | 251 | 68.1 | Plus |
Dgri\GH17766-PA | 169 | GH17766-PA | 53..113 | 71..131 | 223 | 80.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
I-3-PB | 215 | CG11233-PB | 1..215 | 1..215 | 1163 | 100 | Plus |
CG13994-PB | 163 | CG13994-PB | 6..147 | 30..167 | 278 | 43.1 | Plus |
CG13994-PA | 163 | CG13994-PA | 6..147 | 30..167 | 278 | 43.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI17309-PA | 159 | GI17309-PA | 16..105 | 33..127 | 283 | 63.2 | Plus |
Dmoj\GI15102-PA | 170 | GI15102-PA | 4..161 | 15..178 | 252 | 42.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL19060-PA | 156 | GL19060-PA | 12..95 | 40..126 | 265 | 60.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA10854-PA | 217 | GA10854-PA | 105..165 | 71..131 | 298 | 83.6 | Plus |
Dpse\GA12683-PA | 156 | GA12683-PA | 12..95 | 40..126 | 265 | 60.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM22654-PA | 139 | GM22654-PA | 1..139 | 1..139 | 638 | 84.9 | Plus |
Dsec\GM18598-PA | 163 | GM18598-PA | 6..104 | 30..126 | 271 | 55.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD24438-PA | 180 | GD24438-PA | 1..179 | 1..179 | 836 | 86.6 | Plus |
Dsim\GD23382-PA | 163 | GD23382-PA | 6..104 | 30..126 | 271 | 55.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ15772-PA | 151 | GJ15772-PA | 15..100 | 33..127 | 273 | 61.1 | Plus |
Dvir\GJ18910-PA | 212 | GJ18910-PA | 15..118 | 25..130 | 258 | 58.7 | Plus |