Clone AT30951 Report

Search the DGRC for AT30951

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:309
Well:51
Vector:pOTB7
Associated Gene/TranscriptCG9920-RA
Protein status:AT30951.pep: gold
Preliminary Size:709
Sequenced Size:773

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9920 2002-01-01 Sim4 clustering to Release 2
CG9920 2003-01-01 Sim4 clustering to Release 3
CG9920 2003-01-22 Blastp of sequenced clone
CG9920 2008-04-29 Release 5.5 accounting
CG9920 2008-08-15 Release 5.9 accounting
CG9920 2008-12-18 5.12 accounting

Clone Sequence Records

AT30951.complete Sequence

773 bp (773 high quality bases) assembled on 2003-01-22

GenBank Submission: AY075297

> AT30951.complete
AGAAAGTATAGGAACAACATCGTTCTTCCAAAATTAAAAAAAAAAATTAT
ATAATAATTATAAAAAGTGAAAAACATAGTAAAACTCTCACAAACAAGAA
ACGATGTCCAACGTTATTAAGAAGGTGATTCCCATGCTGGACCGCATTCT
AATCCAGCGTTTCGAGGTGAAGACCACCACCGCGGGCGGCATCCTGCTGC
CCGAGGAGTCGGTGCCCAAGGAGATGCAGGGCGTGGTGGTTGCCGTCGGA
CCCGGAGCCCGCAATCCTGCTGGAGCTGGACACTTGTCCGTTGGCGTCAA
GGAGGGCGATCGCGTGCTGTTGCCCAAATACGGTGGAACTAAGGTCGATA
TGGACGACAAGCGCGAGTATGTTCTGTTCCGCGAGAGCGATATCCTTGCT
AAACTGGAATAGATTTGCAACACTTTCCGAAACATCAAAGCCGATATACA
CGATATACATATAATGCTCCAAGCAATACTCATCCTCCTATCTCGTCACT
TATCTTCGGTGGAGACTGTCATTTTGCTTCCGAATTGCGTTCGAAACTAA
ATGATTATAATGAAATGTTATATTTGGTAAATGGCCAATCTACACACTCC
ACACACTTCATCCGACTATGAAACATGTCGCGCCTGCTCTTATAGCTACC
ACTCACACTGCCATATCGTGTAAGGACAGGCCAAATAAACCACTGTAGAT
GTGCCTTTTGTGTCTTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAA

AT30951.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:24:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG9920-RA 913 CG9920-RA 138..852 1..717 3530 99.7 Plus
CG11267.a 500 CG11267.a 26..78 115..167 160 86.7 Plus
CG11267-RA 805 CG11267-RA 250..302 115..167 160 86.7 Plus
CG11267.a 500 CG11267.a 202..256 291..345 155 85.4 Plus
CG11267-RA 805 CG11267-RA 426..480 291..345 155 85.4 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 17:26:41
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 9922161..9922781 716..96 3105 100 Minus
chr3R 27901430 chr3R 9922853..9922950 98..1 490 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:03:21 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 17:26:39
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 14097292..14097913 717..96 3110 100 Minus
3R 32079331 3R 14097985..14098080 98..1 425 98 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:02:16
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 13838123..13838744 717..96 3110 100 Minus
3R 31820162 3R 13838816..13838911 98..1 435 97.9 Minus
3L 28103327 3L 13009465..13009517 115..167 160 86.7 Plus
3L 28103327 3L 13009709..13009763 291..345 155 85.4 Plus
Blast to na_te.dros performed 2019-03-15 17:26:39
Subject Length Description Subject Range Query Range Score Percent Strand
Fw3 3132 Fw3 FW3 3132bp 2926..3056 401..535 132 64.3 Plus

AT30951.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 17:27:53 Download gff for AT30951.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 9922161..9922778 99..716 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:31:37 Download gff for AT30951.complete
Subject Subject Range Query Range Percent Splice Strand
CG9920-RA 1..309 104..412 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:55:02 Download gff for AT30951.complete
Subject Subject Range Query Range Percent Splice Strand
CG9920-RA 1..309 104..412 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:36:36 Download gff for AT30951.complete
Subject Subject Range Query Range Percent Splice Strand
CG9920-RA 1..309 104..412 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:46:05 Download gff for AT30951.complete
Subject Subject Range Query Range Percent Splice Strand
CG9920-RA 1..309 104..412 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:37:58 Download gff for AT30951.complete
Subject Subject Range Query Range Percent Splice Strand
CG9920-RA 1..309 104..412 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:10:13 Download gff for AT30951.complete
Subject Subject Range Query Range Percent Splice Strand
CG9920-RA 1..714 1..716 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:55:02 Download gff for AT30951.complete
Subject Subject Range Query Range Percent Splice Strand
CG9920-RA 1..714 1..716 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:36:36 Download gff for AT30951.complete
Subject Subject Range Query Range Percent Splice Strand
CG9920-RA 1..714 1..716 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:46:05 Download gff for AT30951.complete
Subject Subject Range Query Range Percent Splice Strand
CG9920-RA 1..714 1..716 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:37:58 Download gff for AT30951.complete
Subject Subject Range Query Range Percent Splice Strand
CG9920-RA 1..714 1..716 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:27:53 Download gff for AT30951.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14097293..14097910 99..716 100 <- Minus
3R 14097985..14098080 1..98 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:27:53 Download gff for AT30951.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14097293..14097910 99..716 100 <- Minus
3R 14097985..14098080 1..98 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:27:53 Download gff for AT30951.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14097293..14097910 99..716 100 <- Minus
3R 14097985..14098080 1..98 97   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:36:36 Download gff for AT30951.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 9923015..9923632 99..716 100 <- Minus
arm_3R 9923707..9923802 1..98 97   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:17:07 Download gff for AT30951.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13838124..13838741 99..716 100 <- Minus
3R 13838816..13838911 1..98 97   Minus

AT30951.hyp Sequence

Translation from 103 to 411

> AT30951.hyp
MSNVIKKVIPMLDRILIQRFEVKTTTAGGILLPEESVPKEMQGVVVAVGP
GARNPAGAGHLSVGVKEGDRVLLPKYGGTKVDMDDKREYVLFRESDILAK
LE*

AT30951.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:25:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG9920-PA 102 CG9920-PA 1..102 1..102 511 100 Plus
CG11267-PA 103 CG11267-PA 1..103 1..102 333 64.1 Plus

AT30951.pep Sequence

Translation from 103 to 411

> AT30951.pep
MSNVIKKVIPMLDRILIQRFEVKTTTAGGILLPEESVPKEMQGVVVAVGP
GARNPAGAGHLSVGVKEGDRVLLPKYGGTKVDMDDKREYVLFRESDILAK
LE*

AT30951.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:03:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18793-PA 102 GF18793-PA 1..102 1..102 496 95.1 Plus
Dana\GF24628-PA 104 GF24628-PA 1..104 1..102 350 66.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:03:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21544-PA 102 GG21544-PA 1..102 1..102 508 98 Plus
Dere\GG15616-PA 103 GG15616-PA 1..103 1..102 339 65 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:03:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22450-PA 102 GH22450-PA 1..102 1..102 472 91.2 Plus
Dgri\GH17079-PA 104 GH17079-PA 1..104 1..102 341 65.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:00:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG9920-PA 102 CG9920-PA 1..102 1..102 511 100 Plus
CG11267-PA 103 CG11267-PA 1..103 1..102 333 64.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:03:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24558-PA 102 GI24558-PA 1..102 1..102 480 93.1 Plus
Dmoj\GI11679-PA 94 GI11679-PA 1..94 11..102 314 68.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:03:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23313-PA 102 GL23313-PA 1..102 1..102 500 95.1 Plus
Dper\GL25265-PA 103 GL25265-PA 1..103 1..102 339 66 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:03:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22124-PA 102 GA22124-PA 1..102 1..102 499 94.1 Plus
Dpse\GA10877-PA 103 GA10877-PA 1..103 1..102 339 66 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:03:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25890-PA 102 GM25890-PA 1..102 1..102 517 100 Plus
Dsec\GM25388-PA 103 GM25388-PA 1..103 1..102 339 65 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:03:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20460-PA 116 GD20460-PA 1..116 1..102 492 87.9 Plus
Dsim\GD14421-PA 103 GD14421-PA 1..103 1..102 339 65 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:03:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22624-PA 102 GJ22624-PA 1..102 1..102 473 90.2 Plus
Dvir\GJ11351-PA 94 GJ11351-PA 1..94 11..102 309 67 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:03:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10911-PA 102 GK10911-PA 1..102 1..102 488 93.1 Plus
Dwil\GK17350-PA 104 GK17350-PA 1..104 1..102 351 67.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:03:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10065-PA 102 GE10065-PA 1..102 1..102 515 99 Plus
Dyak\GE21943-PA 103 GE21943-PA 1..103 1..102 339 65 Plus