Clone AT31060 Report

Search the DGRC for AT31060

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:310
Well:60
Vector:pOTB7
Associated Gene/Transcriptsunz-RA
Protein status:AT31060.pep: gold
Preliminary Size:663
Sequenced Size:921

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15179 2002-01-01 Sim4 clustering to Release 2
CG15179 2003-01-01 Sim4 clustering to Release 3
CG15179 2003-01-22 Blastp of sequenced clone
sunz 2008-04-29 Release 5.5 accounting
sunz 2008-08-15 Release 5.9 accounting
sunz 2008-12-18 5.12 accounting

Clone Sequence Records

AT31060.complete Sequence

921 bp (921 high quality bases) assembled on 2003-01-22

GenBank Submission: AY075298

> AT31060.complete
CCCCATTACACAGTACTCTCTTAAAAAACATTTTAAATAATAATTACTTG
TTTACCATTGCCATTAAAAAACACAATGAACCGCATCGACCTTACCCTGG
ACGACATGGCCAACAACAAGTTCCTCACCATGTACAGTACTTTGATCAAG
AGCTTCGCTGCCTCCACGGAGTTTTCCACCAACGAAGTGGTCAGCTTGCT
GATCGTGTTTTACAAGTACGCCCTGAACAACAGGTCCCGCATGATGTCCA
CCAGCCAGCTGTACAATCTATTCCTCGTCAGCTTTGGGATCTTCGACGTG
ACCATCATCGACCGGATTTCGATGAATATCACGCAGGATGGCCGATCAGT
CTCTCCAGAAGCCTGGATGCGGCTGTTCTGTGTGTTCTTCAACGGAAGTC
TGCAGGAGCGAATGAAGTTCGCATTTGAGGTTTATACAAGCGGTGGTGCT
GTGGTTCTGAATCGCGAGGTGGTCGGCGTGGCCATTGAACAATTCTTCAC
TGGCGATGACGACGACGAGGTCAACGAATTGCGAGCGGACATGTGCGAGT
TCATATTCGGAAAATTCGACACTGACAAGGATGGGGTGATAGCGTTTGAA
GAGTACGCCGAAATTGTACAGAATCAGCCTGGATTGCTCGAGTTTTTGGG
TAAAATATTCCCGGATGACAAGGACAGATCACTGGTGGCGTACTGCCACA
ACATTGAGTCTATGTTTCCGCCAGAAGGTTTATATTAAAAGAAAGAAAGG
AGGCTGTTCCTTGTGGAAAATTCTTCGTATTTTGCATAATTGTATACATT
CTCAGCCTGCTAAGGAAAGCTTTCATAAAATAGCGCAAGTGTTGAAAATT
GGCGCTTAGAGGCCTGCAAGCCGGCTTACAATAAAGTCATTTTCCATTAA
GTAAAAAAAAAAAAAAAAAAA

AT31060.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:24:35
Subject Length Description Subject Range Query Range Score Percent Strand
sunz-RA 982 sunz-RA 40..942 1..903 4515 100 Plus
sunz.b 925 sunz.b 20..925 1..903 4460 99.6 Plus
sunz.a 856 sunz.a 235..856 282..903 3110 100 Plus
sunz.a 856 sunz.a 20..234 1..215 1075 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:30:09
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 2455963..2456393 1..431 2155 100 Plus
chr3R 27901430 chr3R 2456612..2456977 537..902 1830 100 Plus
chr3R 27901430 chr3R 2456445..2456555 428..538 555 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:03:25 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:30:07
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 6630170..6630600 1..431 2155 100 Plus
3R 32079331 3R 6630819..6631185 537..903 1835 100 Plus
3R 32079331 3R 6630652..6630762 428..538 555 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:02:17
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 6371001..6371431 1..431 2155 100 Plus
3R 31820162 3R 6371650..6372016 537..903 1835 100 Plus
3R 31820162 3R 6371483..6371593 428..538 555 100 Plus
Blast to na_te.dros performed on 2019-03-15 15:30:07 has no hits.

AT31060.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:30:54 Download gff for AT31060.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 2455963..2456391 1..429 100 -> Plus
chr3R 2456447..2456554 430..537 100 -> Plus
chr3R 2456613..2456977 538..902 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:31:48 Download gff for AT31060.complete
Subject Subject Range Query Range Percent Splice Strand
sunz-RA 1..663 76..738 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:55:03 Download gff for AT31060.complete
Subject Subject Range Query Range Percent Splice Strand
sunz-RA 1..663 76..738 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:30:49 Download gff for AT31060.complete
Subject Subject Range Query Range Percent Splice Strand
sunz-RA 1..663 76..738 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:46:06 Download gff for AT31060.complete
Subject Subject Range Query Range Percent Splice Strand
sunz-RA 1..663 76..738 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:08:21 Download gff for AT31060.complete
Subject Subject Range Query Range Percent Splice Strand
sunz-RA 1..663 76..738 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:10:14 Download gff for AT31060.complete
Subject Subject Range Query Range Percent Splice Strand
sunz-RA 1..902 1..902 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:55:03 Download gff for AT31060.complete
Subject Subject Range Query Range Percent Splice Strand
sunz-RA 1..902 1..902 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:30:49 Download gff for AT31060.complete
Subject Subject Range Query Range Percent Splice Strand
sunz-RA 20..921 1..902 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:46:07 Download gff for AT31060.complete
Subject Subject Range Query Range Percent Splice Strand
sunz-RA 21..922 1..902 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:08:21 Download gff for AT31060.complete
Subject Subject Range Query Range Percent Splice Strand
sunz-RA 20..921 1..902 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:30:54 Download gff for AT31060.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6630170..6630598 1..429 100 -> Plus
3R 6630654..6630761 430..537 100 -> Plus
3R 6630820..6631184 538..902 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:30:54 Download gff for AT31060.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6630170..6630598 1..429 100 -> Plus
3R 6630654..6630761 430..537 100 -> Plus
3R 6630820..6631184 538..902 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:30:54 Download gff for AT31060.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6630170..6630598 1..429 100 -> Plus
3R 6630654..6630761 430..537 100 -> Plus
3R 6630820..6631184 538..902 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:30:49 Download gff for AT31060.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 2455892..2456320 1..429 100 -> Plus
arm_3R 2456376..2456483 430..537 100 -> Plus
arm_3R 2456542..2456906 538..902 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:17:09 Download gff for AT31060.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6371001..6371429 1..429 100 -> Plus
3R 6371485..6371592 430..537 100 -> Plus
3R 6371651..6372015 538..902 100   Plus

AT31060.hyp Sequence

Translation from 75 to 737

> AT31060.hyp
MNRIDLTLDDMANNKFLTMYSTLIKSFAASTEFSTNEVVSLLIVFYKYAL
NNRSRMMSTSQLYNLFLVSFGIFDVTIIDRISMNITQDGRSVSPEAWMRL
FCVFFNGSLQERMKFAFEVYTSGGAVVLNREVVGVAIEQFFTGDDDDEVN
ELRADMCEFIFGKFDTDKDGVIAFEEYAEIVQNQPGLLEFLGKIFPDDKD
RSLVAYCHNIESMFPPEGLY*

AT31060.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:26:11
Subject Length Description Subject Range Query Range Score Percent Strand
sunz-PA 220 CG15179-PA 1..220 1..220 1132 100 Plus
sowi-PA 217 CG15178-PA 1..213 1..211 529 45.1 Plus
CG15177-PA 225 CG15177-PA 1..216 1..213 507 47.2 Plus
CG15177-PB 217 CG15177-PB 1..208 1..213 465 44.9 Plus
d-cup-PA 219 CG14387-PA 2..217 3..218 426 39.4 Plus

AT31060.pep Sequence

Translation from 75 to 737

> AT31060.pep
MNRIDLTLDDMANNKFLTMYSTLIKSFAASTEFSTNEVVSLLIVFYKYAL
NNRSRMMSTSQLYNLFLVSFGIFDVTIIDRISMNITQDGRSVSPEAWMRL
FCVFFNGSLQERMKFAFEVYTSGGAVVLNREVVGVAIEQFFTGDDDDEVN
ELRADMCEFIFGKFDTDKDGVIAFEEYAEIVQNQPGLLEFLGKIFPDDKD
RSLVAYCHNIESMFPPEGLY*

AT31060.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 22:44:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18370-PA 218 GF18370-PA 1..217 1..217 861 72.4 Plus
Dana\GF16646-PA 222 GF16646-PA 1..216 1..214 517 45.8 Plus
Dana\GF16647-PA 221 GF16647-PA 1..216 1..214 494 43.1 Plus
Dana\GF16917-PA 218 GF16917-PA 2..214 3..215 457 40.5 Plus
Dana\GF11793-PA 253 GF11793-PA 3..227 4..214 350 39.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 22:44:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13568-PA 220 GG13568-PA 1..220 1..220 1109 95 Plus
Dere\GG10380-PA 217 GG10380-PA 1..213 1..211 539 45.1 Plus
Dere\GG10369-PA 225 GG10369-PA 1..217 1..214 500 46.1 Plus
Dere\GG19247-PA 219 GG19247-PA 2..214 3..215 438 40 Plus
Dere\GG22989-PA 244 GG22989-PA 1..226 1..214 366 37.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 22:44:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15665-PA 218 GH15665-PA 1..218 1..218 712 61.8 Plus
Dgri\GH20009-PA 263 GH20009-PA 1..198 1..188 287 33 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:09:01
Subject Length Description Subject Range Query Range Score Percent Strand
sunz-PA 220 CG15179-PA 1..220 1..220 1132 100 Plus
sowi-PA 217 CG15178-PA 1..213 1..211 529 45.1 Plus
CG15177-PA 225 CG15177-PA 1..216 1..213 507 47.2 Plus
CG15177-PB 217 CG15177-PB 1..208 1..213 465 44.9 Plus
d-cup-PA 219 CG14387-PA 2..217 3..218 426 39.4 Plus
CG3565-PA 244 CG3565-PA 1..226 1..214 356 37.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 22:44:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22488-PA 220 GI22488-PA 1..219 1..217 722 60.7 Plus
Dmoj\GI19190-PA 221 GI19190-PA 1..220 1..210 371 36.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 22:44:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21763-PA 220 GL21763-PA 1..219 1..217 837 68.5 Plus
Dper\GL22057-PA 224 GL22057-PA 1..220 1..218 535 44.1 Plus
Dper\GL10228-PA 234 GL10228-PA 1..233 1..220 398 39.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 22:44:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13552-PA 220 GA13552-PA 1..219 1..217 831 68.5 Plus
Dpse\GA13550-PA 224 GA13550-PA 1..220 1..218 535 44.1 Plus
Dpse\GA17523-PA 234 GA17523-PA 1..233 1..220 395 39.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 22:44:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10904-PA 220 GM10904-PA 1..220 1..220 1137 97.7 Plus
Dsec\GM10541-PA 217 GM10541-PA 1..213 1..211 540 44.6 Plus
Dsec\GM10540-PA 225 GM10540-PA 1..217 1..214 512 47 Plus
Dsec\GM24064-PA 219 GM24064-PA 2..217 3..218 427 39 Plus
Dsec\GM11883-PA 244 GM11883-PA 1..226 1..214 338 38.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 22:44:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19884-PA 197 GD19884-PA 1..196 1..196 1000 97.4 Plus
Dsim\GD19538-PA 225 GD19538-PA 1..217 1..214 512 47 Plus
Dsim\GD19539-PA 233 GD19539-PA 1..194 1..192 488 45.4 Plus
Dsim\GD18861-PA 219 GD18861-PA 2..217 3..218 427 39 Plus
Dsim\GD11881-PA 244 GD11881-PA 1..226 1..214 337 38.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 22:44:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10087-PA 158 GJ10087-PA 1..157 1..155 482 58 Plus
Dvir\GJ20255-PA 224 GJ20255-PA 1..224 1..212 387 38.4 Plus
Dvir\GJ23423-PA 63 GJ23423-PA 1..62 156..217 224 67.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 22:44:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11579-PA 214 GK11579-PA 1..205 1..203 631 58.5 Plus
Dwil\GK11523-PA 219 GK11523-PA 1..217 1..215 539 46.5 Plus
Dwil\GK22790-PA 222 GK22790-PA 2..216 3..212 393 35.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 22:44:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10232-PA 220 GE10232-PA 1..220 1..220 1094 93.6 Plus
Dyak\GE24094-PA 207 GE24094-PA 1..203 11..211 515 44.8 Plus
Dyak\GE24093-PA 225 GE24093-PA 1..217 1..214 505 46.5 Plus
Dyak\GE26222-PA 219 GE26222-PA 2..214 3..215 424 39.1 Plus
Dyak\GE14426-PA 244 GE14426-PA 1..226 1..214 331 37.2 Plus