Clone AT31162 Report

Search the DGRC for AT31162

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:311
Well:62
Vector:pOTB7
Associated Gene/TranscriptCG4073-RA
Protein status:AT31162.pep: gold
Preliminary Size:882
Sequenced Size:1134

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4073 2002-01-01 Sim4 clustering to Release 2
CG4073 2002-01-18 Blastp of sequenced clone
CG4073 2003-01-01 Sim4 clustering to Release 3
CG4073 2008-04-29 Release 5.5 accounting
CG4073 2008-08-15 Release 5.9 accounting
CG4073 2008-12-18 5.12 accounting

Clone Sequence Records

AT31162.complete Sequence

1134 bp (1134 high quality bases) assembled on 2002-01-18

GenBank Submission: AY089487

> AT31162.complete
AATTGTAACATAACACTTTTTGCCCACAGTACACCCACCGCCTTGTTAAT
CAAATATATTCATATTTAATATACATGTTCATAGCACCCAGCAGGTTCCC
ACAACGGGGGTGGTGGTATCAACGCGCAGAAAGATGAGCAGGCCAAATCC
CACGCCACGTTCATCGACGGGTCTACGCAAACCGACTGGTCAAAGATCAA
CACCTCCACCCAGGCCACCACCTCATGTTCCCGCTCCTGCTCCACCACCG
CATGAGCCTGCGAAACCATATGGAGAATCCCCGGGCCTGCTGAGCCCGGT
CGCATCGTCGGGTCCTTTGCGCCAACGCTCTTCTGTGCACCTGAGGAAGA
AACACCTCGGTTGGGTCTACTTGATCCACGCGGTTCTATCGGCAAGTGCA
GTAATTCAGCTTGTGGTCCTGCGGCTCTGCAATAAGGACTTCGGGGAGCT
AATTAGCCCATCGGTGCCCAGCTTCGTGTGGCTGCTCCTGGCCGTGGGAT
GTGTGCTGATCATGGCCTACGTGTACCTGGCCAACCAGTGTCCGTGCAAT
GGTCTGCTGGCCATTGTCATCGTGGAGGTGATAGTGATATTTGTGAATTG
CCACCGGTGGGCGCGTCTATCGATGCTCTGGATGACTGGTGTCCTGTCAC
TCGTGCTGGCCCTGAACGTCATGCTCTACTTGATGGGCGTCTATCTGCCG
CTGAAAATACTGCCCGGTAGCATCTTCATGATCGTCCTCACATTCTGTTG
CATAGCGATTGTCGTTTCGATCTACTTGATTGTGTATCTAAACGGCAATC
GCTATATAATGCGATACGTCTCGATGGTCAGTCTGATCTACGTGGCTAGT
CTCATCCTCTTCACCATCACCGTTATCCACCAGCGAAGATTTGAGCATAC
GGATCGCACCGAATATGTCCTGCAGGCCACCGTTCTGGCCATGCTGTTCG
TCTATATGATTCACCCACTCTCAACTATGGTGCGATTTGGGCAGTTTTTG
GTGGACCATGTATAATATAAAATTGTTGGAAGTGTATCATCATATCTAAT
ATAGTCTTAAGAAATGTAATATTGCCCAAATTCCTATATATACATATATA
TTGTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

AT31162.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:28:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG4073-RA 1104 CG4073-RA 1..1104 1..1104 5475 99.7 Plus
CG4073.a 1047 CG4073.a 1..826 1..826 4115 99.8 Plus
CG4073.a 1047 CG4073.a 826..1047 883..1104 1080 99 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 12:52:12
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 6540342..6541445 1..1104 5520 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:03:32 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 12:52:10
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 10714798..10715902 1..1105 5480 99.7 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:57:17
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 10455629..10456733 1..1105 5480 99.7 Plus
Blast to na_te.dros performed on 2019-03-16 12:52:10 has no hits.

AT31162.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 12:53:27 Download gff for AT31162.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 6540342..6541445 1..1104 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:31:59 Download gff for AT31162.complete
Subject Subject Range Query Range Percent Splice Strand
CG4073-RA 1..882 134..1015 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:45:17 Download gff for AT31162.complete
Subject Subject Range Query Range Percent Splice Strand
CG4073-RA 1..882 134..1015 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:11:53 Download gff for AT31162.complete
Subject Subject Range Query Range Percent Splice Strand
CG4073-RA 1..882 134..1015 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:13:43 Download gff for AT31162.complete
Subject Subject Range Query Range Percent Splice Strand
CG4073-RA 1..882 134..1015 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:10:20 Download gff for AT31162.complete
Subject Subject Range Query Range Percent Splice Strand
CG4073-RA 1..882 134..1015 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:09:45 Download gff for AT31162.complete
Subject Subject Range Query Range Percent Splice Strand
CG4073-RA 1..1102 1..1102 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:45:17 Download gff for AT31162.complete
Subject Subject Range Query Range Percent Splice Strand
CG4073-RA 1..1102 1..1102 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:11:53 Download gff for AT31162.complete
Subject Subject Range Query Range Percent Splice Strand
CG4073-RA 1..1104 1..1104 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:13:44 Download gff for AT31162.complete
Subject Subject Range Query Range Percent Splice Strand
CG4073-RA 1..1102 1..1102 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:10:20 Download gff for AT31162.complete
Subject Subject Range Query Range Percent Splice Strand
CG4073-RA 1..1104 1..1104 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:53:27 Download gff for AT31162.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10714798..10715901 1..1104 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:53:27 Download gff for AT31162.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10714798..10715901 1..1104 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:53:27 Download gff for AT31162.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10714798..10715901 1..1104 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:11:53 Download gff for AT31162.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 6540520..6541623 1..1104 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:47:38 Download gff for AT31162.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10455629..10456732 1..1104 99   Plus

AT31162.pep Sequence

Translation from 133 to 1014

> AT31162.pep
MSRPNPTPRSSTGLRKPTGQRSTPPPRPPPHVPAPAPPPHEPAKPYGESP
GLLSPVASSGPLRQRSSVHLRKKHLGWVYLIHAVLSASAVIQLVVLRLCN
KDFGELISPSVPSFVWLLLAVGCVLIMAYVYLANQCPCNGLLAIVIVEVI
VIFVNCHRWARLSMLWMTGVLSLVLALNVMLYLMGVYLPLKILPGSIFMI
VLTFCCIAIVVSIYLIVYLNGNRYIMRYVSMVSLIYVASLILFTITVIHQ
RRFEHTDRTEYVLQATVLAMLFVYMIHPLSTMVRFGQFLVDHV*

AT31162.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:54:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17548-PA 227 GF17548-PA 7..222 71..286 439 44 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:54:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17650-PA 297 GG17650-PA 1..297 1..293 1052 73.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:27:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG4073-PA 293 CG4073-PA 1..293 1..293 1522 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:54:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12627-PA 254 GL12627-PA 13..226 71..286 279 31.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:54:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17937-PA 254 GA17937-PA 2..226 57..286 278 30.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:54:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23893-PA 294 GM23893-PA 1..294 1..293 1239 92.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:54:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18704-PA 294 GD18704-PA 1..294 1..293 1201 86.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:54:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26045-PA 291 GE26045-PA 1..291 1..293 885 66.8 Plus

AT31162.hyp Sequence

Translation from 133 to 1014

> AT31162.hyp
MSRPNPTPRSSTGLRKPTGQRSTPPPRPPPHVPAPAPPPHEPAKPYGESP
GLLSPVASSGPLRQRSSVHLRKKHLGWVYLIHAVLSASAVIQLVVLRLCN
KDFGELISPSVPSFVWLLLAVGCVLIMAYVYLANQCPCNGLLAIVIVEVI
VIFVNCHRWARLSMLWMTGVLSLVLALNVMLYLMGVYLPLKILPGSIFMI
VLTFCCIAIVVSIYLIVYLNGNRYIMRYVSMVSLIYVASLILFTITVIHQ
RRFEHTDRTEYVLQATVLAMLFVYMIHPLSTMVRFGQFLVDHV*

AT31162.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:26:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG4073-PA 293 CG4073-PA 1..293 1..293 1522 100 Plus