Clone AT31219 Report

Search the DGRC for AT31219

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:312
Well:19
Vector:pOTB7
Associated Gene/TranscriptRpn13R-RA
Protein status:AT31219.pep: gold
Preliminary Size:975
Sequenced Size:1106

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6789 2002-01-01 Sim4 clustering to Release 2
CG6789 2002-04-21 Blastp of sequenced clone
CG6789 2003-01-01 Sim4 clustering to Release 3
CG6789 2008-04-29 Release 5.5 accounting
CG6789 2008-08-15 Release 5.9 accounting
CG6789 2008-12-18 5.12 accounting

Clone Sequence Records

AT31219.complete Sequence

1106 bp (1106 high quality bases) assembled on 2002-04-21

GenBank Submission: AY113335

> AT31219.complete
ATATTAACTATTCACACAATTCAAGCGATTGGTAATAACTCGAAAATTTC
CAGTATCCACATGGCCCAGTCGAATGCACACAATTTGGTCGAGTACAAGG
CCGGCCGCATGGTCCTTCTAGGCAAGATGGTCGAACCCGATGACCGCAAA
GGACTGCTCTTTGTGCGCCGATCCGCCGATGATAATCAGCTCCATATCCA
CTGGATGGATCGGCGTTCCGGGTCCGTTGAGCTGGATATTGTAGCAACGC
CGGGCGTCCTCGAGTTCCGTCGCATTGATCAGTGCAAAACCGGTCGGGTT
TATGTCCTAAAGTATACACGATCGACGCAGCGTTACTTTTTCTGGATGCA
GGAGCTGCAGGCGGATGGGGATGCGTTATTTTGTCAGCGGGTCAATGAAT
TGATTGCCAGTGGTGAACGCCAAAGGGATGAGATTGCGGCGGCCGAGGGC
GATATGGATACGGATGCGGATCATACAACAGCACGACGCGGTTTCGGTGG
CAGTGAGAATCCTCAAATTCTGGAAGAGATGCTGGTCGAAACGCAAGCAA
CTTGGCTACCAGCTAACCGGAGTTTGAATCATTGGCAAACTGGTGATGCG
ATGGAAGAACCGCCCTTGCCATTTGCCGATCCCGATGCAAATACAGATAC
AGATACAGATACATATACATCAGAGTCGGGTATACAGACATTCGATTTGG
CAGCTGTTTTACGCCTACATGGCGCCGAAGCAGTGGACAAAGTTCTAAGT
TGCCCATCGAGACGTGAAAAACTAATGGCCCAATTGCCCAAAGATCATGA
GGCGATGGATGAGCAGTCAGACATACTGGAGCATTTGCATTCGGCGCAAT
TCTACGAATCCTTGTCCTCTTTTTCCGTAGGACTTCATTCTGGTGCACTC
AGAAAGAGTCTGGAGCCTCTATTGCAAAGTGATGACAATCGCGAGGCCTT
GAATGCCGCTCAAGTTGGGGATGTTGAGCGTTTTCTACGTGAACTTGAAC
GAAACGATGGGGATTATGGTGGGCCAACCGATTGAACCGTGAGGTTCTTA
TAAATATATTTAAATATAGTTAATTAAATATGGCGCATAAAAAAAAAAAA
AAAAAA

AT31219.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:14:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG6789-RA 1092 CG6789-RA 1..1090 1..1090 5435 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:20:59
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 5024605..5025692 1..1088 5350 99.4 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:03:34 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:20:57
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 5131898..5132987 1..1090 5435 99.9 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:44:22
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 5139996..5141085 1..1090 5435 99.9 Plus
Blast to na_te.dros performed on 2019-03-16 02:20:57 has no hits.

AT31219.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:21:49 Download gff for AT31219.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 5024605..5025651 1..1047 95 == Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:32:03 Download gff for AT31219.complete
Subject Subject Range Query Range Percent Splice Strand
CG6789-RA 1..975 61..1035 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:00:08 Download gff for AT31219.complete
Subject Subject Range Query Range Percent Splice Strand
CG6789-RA 1..975 61..1035 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:16:22 Download gff for AT31219.complete
Subject Subject Range Query Range Percent Splice Strand
Rpn13R-RA 1..975 61..1035 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:53:25 Download gff for AT31219.complete
Subject Subject Range Query Range Percent Splice Strand
CG6789-RA 1..975 61..1035 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:06:34 Download gff for AT31219.complete
Subject Subject Range Query Range Percent Splice Strand
Rpn13R-RA 1..975 61..1035 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:41:04 Download gff for AT31219.complete
Subject Subject Range Query Range Percent Splice Strand
CG6789-RA 1..1088 1..1088 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:00:08 Download gff for AT31219.complete
Subject Subject Range Query Range Percent Splice Strand
CG6789-RA 1..1088 1..1088 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:16:22 Download gff for AT31219.complete
Subject Subject Range Query Range Percent Splice Strand
Rpn13R-RA 1..1088 1..1088 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:53:25 Download gff for AT31219.complete
Subject Subject Range Query Range Percent Splice Strand
CG6789-RA 1..1088 1..1088 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:06:34 Download gff for AT31219.complete
Subject Subject Range Query Range Percent Splice Strand
Rpn13R-RA 1..1088 1..1088 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:21:49 Download gff for AT31219.complete
Subject Subject Range Query Range Percent Splice Strand
X 5131898..5132985 1..1088 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:21:49 Download gff for AT31219.complete
Subject Subject Range Query Range Percent Splice Strand
X 5131898..5132985 1..1088 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:21:49 Download gff for AT31219.complete
Subject Subject Range Query Range Percent Splice Strand
X 5131898..5132985 1..1088 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:16:22 Download gff for AT31219.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 5025931..5027018 1..1088 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:25:36 Download gff for AT31219.complete
Subject Subject Range Query Range Percent Splice Strand
X 5139996..5141083 1..1088 99   Plus

AT31219.hyp Sequence

Translation from 1 to 1034

> AT31219.hyp
ILTIHTIQAIGNNSKISSIHMAQSNAHNLVEYKAGRMVLLGKMVEPDDRK
GLLFVRRSADDNQLHIHWMDRRSGSVELDIVATPGVLEFRRIDQCKTGRV
YVLKYTRSTQRYFFWMQELQADGDALFCQRVNELIASGERQRDEIAAAEG
DMDTDADHTTARRGFGGSENPQILEEMLVETQATWLPANRSLNHWQTGDA
MEEPPLPFADPDANTDTDTDTYTSESGIQTFDLAAVLRLHGAEAVDKVLS
CPSRREKLMAQLPKDHEAMDEQSDILEHLHSAQFYESLSSFSVGLHSGAL
RKSLEPLLQSDDNREALNAAQVGDVERFLRELERNDGDYGGPTD*

AT31219.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:26:40
Subject Length Description Subject Range Query Range Score Percent Strand
Rpn13R-PA 324 CG6789-PA 1..324 21..344 1689 100 Plus
Rpn13-PF 389 CG13349-PF 10..344 22..335 434 32.6 Plus
Rpn13-PB 389 CG13349-PB 10..344 22..335 434 32.6 Plus
Rpn13-PA 389 CG13349-PA 10..344 22..335 434 32.6 Plus
Rpn13-PE 424 CG13349-PE 10..379 22..335 419 31.6 Plus

AT31219.pep Sequence

Translation from 60 to 1034

> AT31219.pep
MAQSNAHNLVEYKAGRMVLLGKMVEPDDRKGLLFVRRSADDNQLHIHWMD
RRSGSVELDIVATPGVLEFRRIDQCKTGRVYVLKYTRSTQRYFFWMQELQ
ADGDALFCQRVNELIASGERQRDEIAAAEGDMDTDADHTTARRGFGGSEN
PQILEEMLVETQATWLPANRSLNHWQTGDAMEEPPLPFADPDANTDTDTD
TYTSESGIQTFDLAAVLRLHGAEAVDKVLSCPSRREKLMAQLPKDHEAMD
EQSDILEHLHSAQFYESLSSFSVGLHSGALRKSLEPLLQSDDNREALNAA
QVGDVERFLRELERNDGDYGGPTD*

AT31219.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 01:42:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21327-PA 318 GF21327-PA 1..311 17..312 613 45.9 Plus
Dana\GF11152-PA 387 GF11152-PA 18..347 10..315 423 32.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 01:42:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18742-PA 402 GG18742-PA 91..402 1..324 1194 71.7 Plus
Dere\GG22456-PA 389 GG22456-PA 18..344 10..315 416 33.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 01:42:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22954-PA 408 GH22954-PA 8..121 1..115 342 51.3 Plus
Dgri\GH24600-PA 108 GH24600-PA 1..92 23..115 278 54.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:08:20
Subject Length Description Subject Range Query Range Score Percent Strand
Rpn13R-PA 324 CG6789-PA 1..324 1..324 1689 100 Plus
Rpn13-PF 389 CG13349-PF 10..344 2..315 434 32.6 Plus
Rpn13-PB 389 CG13349-PB 10..344 2..315 434 32.6 Plus
Rpn13-PA 389 CG13349-PA 10..344 2..315 434 32.6 Plus
Rpn13-PE 424 CG13349-PE 10..379 2..315 419 31.6 Plus
Rpn13-PD 424 CG13349-PD 10..379 2..315 419 31.6 Plus
Rpn13-PG 424 CG13349-PG 10..379 2..315 419 31.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 01:42:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18444-PA 416 GI18444-PA 17..121 10..115 328 52.8 Plus
Dmoj\GI15270-PA 203 GI15270-PA 75..191 2..119 302 44.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 01:42:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17076-PA 384 GL17076-PA 18..345 10..315 424 32.7 Plus
Dper\GL14276-PA 204 GL14276-PA 2..136 7..151 323 49.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 01:42:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12224-PA 384 GA12224-PA 18..345 10..315 424 32.7 Plus
Dpse\GA22734-PA 319 GA22734-PA 3..305 8..312 356 35.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 01:42:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12384-PA 322 GM12384-PA 1..322 1..324 1435 83 Plus
Dsec\GM20242-PA 389 GM20242-PA 18..344 10..315 413 32.5 Plus
Dsec\GM23253-PA 389 GM23253-PA 18..344 10..315 413 32.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 01:42:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25728-PA 389 GD25728-PA 18..344 10..315 407 32.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 01:42:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16842-PA 199 GJ16842-PA 75..183 9..118 335 55.5 Plus
Dvir\GJ21528-PA 406 GJ21528-PA 17..121 10..115 329 52.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 01:42:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17850-PA 397 GK17850-PA 16..121 9..115 346 56.1 Plus
Dwil\GK10286-PA 288 GK10286-PA 171..284 211..315 163 36.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 01:42:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16384-PA 306 GE16384-PA 1..302 1..316 1152 71.3 Plus
Dyak\GE13327-PA 389 GE13327-PA 18..344 10..315 423 33.8 Plus