Clone AT31406 Report

Search the DGRC for AT31406

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:314
Well:6
Vector:pOTB7
Associated Gene/TranscriptCG13994-RA
Protein status:AT31406.pep: gold
Preliminary Size:492
Sequenced Size:630

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13994 2002-01-01 Sim4 clustering to Release 2
CG13994 2003-01-01 Sim4 clustering to Release 3
CG13994 2003-01-22 Blastp of sequenced clone
CG13994 2008-04-29 Release 5.5 accounting
CG13994 2008-08-15 Release 5.9 accounting
CG13994 2008-12-18 5.12 accounting

Clone Sequence Records

AT31406.complete Sequence

630 bp (630 high quality bases) assembled on 2003-01-22

GenBank Submission: AY075302

> AT31406.complete
GAAAAATGGCACATAAGCAGAGCACGAACAATGAGACATCCAATGGCTCG
ACAACTGAAATAATTGACGAAACCGATGCCCGTGCTCAATTGGAATCGGG
CCGGACCACACCCACTCTTCTGTTGCGCCTCGAACATCCGCGTAATGAAC
GCCGGGTGGCCTTTCACGCTGGGATCATCGACAACGAGCATTTGAATCGC
AAGAAGTCCAAATGCTGCTGCATTTACAAAAAACCTCTCGCGTTCGGCGA
GAGCTCCTCTGAGGATGACGAAGACTGTGAGCACTGCTTTGGACATCCGG
AAAAGCGTCAGAGAAACGCAAAACACAATCACAATCACGGGGACAAACCA
TGCACGGAGGCGTCGCATCCGGAAGGACCTTCGACATCAACGCAGGCCGC
GCACATCAGTCAACCGCCAGCCGAGCCTGTTGAATCGAAGACCGATCCAA
AACCACCTACCCCAGGTGTTGACTTTGAGCAGACGGGCAGCTCGTAGAAT
GTATATATATAATTATAAACGTTAACAACATGGAACCAACTAGCAAGCAC
TCAGATCTACAAAGACGGTGTTTTTAGGCAGTAAGAACCACTTGGGGATT
TGAAAAAAAAAAAAAAAAAAAAAAAAAAAA

AT31406.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:44:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG13994.a 789 CG13994.a 183..787 1..605 2995 99.6 Plus
CG13994-RA 762 CG13994-RA 156..760 1..605 2995 99.6 Plus
Fbw5-RA 2369 Fbw5-RA 2200..2369 605..436 850 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 17:34:44
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 6062334..6062722 214..602 1945 100 Plus
chr2L 23010047 chr2L 6062069..6062282 1..214 1040 99.1 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:03:45 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 17:34:42
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 6063283..6063674 214..605 1960 100 Plus
2L 23513712 2L 6063018..6063231 1..214 1040 99.1 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:05:28
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 6063283..6063674 214..605 1960 100 Plus
2L 23513712 2L 6063018..6063231 1..214 1040 99 Plus
Blast to na_te.dros performed 2019-03-15 17:34:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dmer\R1A3 3772 Dmer\R1A3 MERCR1A3 3772bp 3481..3541 294..234 125 67.2 Minus

AT31406.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 17:35:33 Download gff for AT31406.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 6062069..6062281 1..213 99 -> Plus
chr2L 6062334..6062722 214..602 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:32:21 Download gff for AT31406.complete
Subject Subject Range Query Range Percent Splice Strand
CG13994-RA 1..492 6..497 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:38:48 Download gff for AT31406.complete
Subject Subject Range Query Range Percent Splice Strand
CG13994-RA 1..492 6..497 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:40:13 Download gff for AT31406.complete
Subject Subject Range Query Range Percent Splice Strand
CG13994-RA 1..492 6..497 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:15:39 Download gff for AT31406.complete
Subject Subject Range Query Range Percent Splice Strand
CG13994-RA 1..492 6..497 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:41:16 Download gff for AT31406.complete
Subject Subject Range Query Range Percent Splice Strand
CG13994-RA 1..492 6..497 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:43:18 Download gff for AT31406.complete
Subject Subject Range Query Range Percent Splice Strand
CG13994-RA 1..602 1..602 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:38:47 Download gff for AT31406.complete
Subject Subject Range Query Range Percent Splice Strand
CG13994-RA 1..602 1..602 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:40:13 Download gff for AT31406.complete
Subject Subject Range Query Range Percent Splice Strand
CG13994-RA 30..631 1..602 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:15:40 Download gff for AT31406.complete
Subject Subject Range Query Range Percent Splice Strand
CG13994-RA 1..602 1..602 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:41:16 Download gff for AT31406.complete
Subject Subject Range Query Range Percent Splice Strand
CG13994-RA 30..631 1..602 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:35:33 Download gff for AT31406.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6063018..6063230 1..213 99 -> Plus
2L 6063283..6063671 214..602 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:35:33 Download gff for AT31406.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6063018..6063230 1..213 99 -> Plus
2L 6063283..6063671 214..602 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:35:33 Download gff for AT31406.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6063018..6063230 1..213 99 -> Plus
2L 6063283..6063671 214..602 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:40:13 Download gff for AT31406.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 6063018..6063230 1..213 99 -> Plus
arm_2L 6063283..6063671 214..602 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:51:35 Download gff for AT31406.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6063018..6063230 1..213 99 -> Plus
2L 6063283..6063671 214..602 100   Plus

AT31406.hyp Sequence

Translation from 2 to 496

> AT31406.hyp
KMAHKQSTNNETSNGSTTEIIDETDARAQLESGRTTPTLLLRLEHPRNER
RVAFHAGIIDNEHLNRKKSKCCCIYKKPLAFGESSSEDDEDCEHCFGHPE
KRQRNAKHNHNHGDKPCTEASHPEGPSTSTQAAHISQPPAEPVESKTDPK
PPTPGVDFEQTGSS*

AT31406.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:27:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG13994-PB 163 CG13994-PB 1..163 2..164 891 100 Plus
CG13994-PA 163 CG13994-PA 1..163 2..164 891 100 Plus
I-3-PB 215 CG11233-PB 30..167 7..148 278 43.1 Plus

AT31406.pep Sequence

Translation from 5 to 496

> AT31406.pep
MAHKQSTNNETSNGSTTEIIDETDARAQLESGRTTPTLLLRLEHPRNERR
VAFHAGIIDNEHLNRKKSKCCCIYKKPLAFGESSSEDDEDCEHCFGHPEK
RQRNAKHNHNHGDKPCTEASHPEGPSTSTQAAHISQPPAEPVESKTDPKP
PTPGVDFEQTGSS*

AT31406.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 21:58:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14499-PA 163 GF14499-PA 7..162 9..162 546 67.9 Plus
Dana\GF21704-PA 274 GF21704-PA 132..187 49..104 247 73.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 21:58:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23925-PA 161 GG23925-PA 1..160 1..162 670 81.5 Plus
Dere\GG17569-PA 193 GG17569-PA 34..127 9..104 272 55.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 21:58:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10799-PA 150 GH10799-PA 1..122 1..131 359 61.4 Plus
Dgri\GH17766-PA 169 GH17766-PA 42..108 38..104 210 65.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:08:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG13994-PB 163 CG13994-PB 1..163 1..163 891 100 Plus
CG13994-PA 163 CG13994-PA 1..163 1..163 891 100 Plus
I-3-PB 215 CG11233-PB 30..167 6..147 278 43.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 21:58:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17309-PA 159 GI17309-PA 1..154 1..160 419 55.6 Plus
Dmoj\GI15102-PA 170 GI15102-PA 36..113 27..104 203 56.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 21:58:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19060-PA 156 GL19060-PA 3..156 5..163 457 63.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 21:58:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12683-PA 156 GA12683-PA 3..156 5..163 458 63.6 Plus
Dpse\GA10854-PA 217 GA10854-PA 105..160 49..104 231 67.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 21:58:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18598-PA 163 GM18598-PA 1..163 1..163 811 93.3 Plus
Dsec\GM22654-PA 139 GM22654-PA 34..126 10..104 284 57.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 21:58:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23382-PA 163 GD23382-PA 1..163 1..163 811 93.3 Plus
Dsim\GD24438-PA 180 GD24438-PA 34..126 10..104 279 56.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 21:58:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15772-PA 151 GJ15772-PA 1..139 1..137 372 53.5 Plus
Dvir\GJ18910-PA 212 GJ18910-PA 51..114 38..104 204 64.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 21:58:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14722-PA 162 GK14722-PA 10..122 14..125 384 66.7 Plus
Dwil\GK20046-PA 149 GK20046-PA 65..131 38..104 197 59.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 21:58:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25877-PA 161 GE25877-PA 1..160 1..162 732 85.8 Plus
Dyak\GE15329-PA 184 GE15329-PA 45..117 35..104 269 71.2 Plus