Clone AT31812 Report

Search the DGRC for AT31812

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:318
Well:12
Vector:pOTB7
Associated Gene/TranscriptCG32588-RA
Protein status:AT31812.pep: gold
Sequenced Size:695

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9095 2002-01-01 Sim4 clustering to Release 2
CG32588 2003-01-01 Sim4 clustering to Release 3
CG32588 2003-01-22 Blastp of sequenced clone
CG32588 2008-04-29 Release 5.5 accounting
CG32588 2008-08-15 Release 5.9 accounting
CG32588 2008-12-18 5.12 accounting

Clone Sequence Records

AT31812.complete Sequence

695 bp (695 high quality bases) assembled on 2003-01-22

GenBank Submission: AY075307

> AT31812.complete
CAGTCATCCCCTTTGACTTGAACGAAGCACCTATTTATACATTCTTTTAT
AAATTTGGAAAATTTATTTGTACATTTCGGCATGACATTCTTCGAGCAGA
TCAGTGATCACTTTTGCCGCGTTGTGCACACCAATCTCAAGATACCTCTA
TCATGTTGCGAAAGGCGCATCAACTGGAAAATCTCGAAAAGTATCGATTT
ATTGGTATTCTTTTATACCCTCAACATCGGTGTCCTTCGATTGTTAATAA
ATTTTATAGATTTCATGATCGTTTTCTTCGGATGGCCAAGCAATCTTTTG
ATTTTAAAGGACTTCAATTCGCGGCGCTTTCGAGCGCTCACACACTTTTT
ACTGGTGAGAGCGTACATGCTAATGATATACTCCATTGTATTTATCACTC
CGCATAAGAATAATATCTTCGTTCCGCTTTTTGCCATCATCATGACCATC
GATGTGTATGTCATTAAATTAGATATGAAGCGACGTGGATTGATGCCTCT
GGAGCGCAGTGTGCCCCCCCTATGGGAAATATTGATCAGCTTGTGCTGTG
TTGTTGCCGGGCAATGGCTGCTCAAGTATTTGATCTTTCATTAGCGTACG
GATTTCATTGTAATGTTTTGTTCGCCTTATAATTGCTTTTTTTCTGAAAT
ATACATTGAATACATTGTCACTCCTCTAAAAAAAAAAAAAAAAAA

AT31812.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:44:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG32588-RA 694 CG32588-RA 14..692 1..679 3380 99.8 Plus
CG33252-RA 880 CG33252-RA 148..342 88..282 405 80.5 Plus
CG33252-RA 880 CG33252-RA 359..480 284..405 205 77.8 Plus
CG33252-RA 880 CG33252-RA 39..83 1..45 150 88.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:30:19
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 15095915..15096198 677..394 1420 100 Minus
chrX 22417052 chrX 15096502..15096744 243..1 1215 100 Minus
chrX 22417052 chrX 15096277..15096427 393..243 755 100 Minus
chrX 22417052 chrX 15111065..15111224 240..81 425 84.4 Minus
chrX 22417052 chrX 16786566..16786718 240..88 300 79.7 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:04:09 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:30:18
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 15205805..15206090 679..394 1430 100 Minus
X 23542271 X 15206394..15206636 243..1 1215 100 Minus
X 23542271 X 15206169..15206319 393..243 740 99.3 Minus
X 23542271 X 15220940..15221099 240..81 425 84.4 Minus
X 23542271 X 16896936..16897088 240..88 300 79.7 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:05:28
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 15213903..15214188 679..394 1430 100 Minus
X 23527363 X 15214492..15214734 243..1 1215 100 Minus
X 23527363 X 15214267..15214417 393..243 740 99.3 Minus
X 23527363 X 15229038..15229197 240..81 425 84.3 Minus
X 23527363 X 16905034..16905186 240..88 300 79.7 Minus
X 23527363 X 16904787..16904896 393..284 175 77.2 Minus
X 23527363 X 15229262..15229301 40..1 155 92.5 Minus
X 23527363 X 16905251..16905295 45..1 150 88.8 Minus
X 23527363 X 15228822..15228900 362..284 140 78.4 Minus
X 23527363 X 16904913..16904946 282..249 140 94.1 Minus
Blast to na_te.dros performed on 2019-03-16 07:30:18 has no hits.

AT31812.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:31:19 Download gff for AT31812.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 15095915..15096198 394..677 100 <- Minus
chrX 15096277..15096426 244..393 100 <- Minus
chrX 15096502..15096744 1..243 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:32:52 Download gff for AT31812.complete
Subject Subject Range Query Range Percent Splice Strand
CG32588-RA 1..513 82..594 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:38:49 Download gff for AT31812.complete
Subject Subject Range Query Range Percent Splice Strand
CG32588-RA 1..513 82..594 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:07:52 Download gff for AT31812.complete
Subject Subject Range Query Range Percent Splice Strand
CG32588-RA 1..513 82..594 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:15:41 Download gff for AT31812.complete
Subject Subject Range Query Range Percent Splice Strand
CG32588-RA 1..513 82..594 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:32:41 Download gff for AT31812.complete
Subject Subject Range Query Range Percent Splice Strand
CG32588-RA 1..513 82..594 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:43:19 Download gff for AT31812.complete
Subject Subject Range Query Range Percent Splice Strand
CG32588-RA 1..673 1..673 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:38:49 Download gff for AT31812.complete
Subject Subject Range Query Range Percent Splice Strand
CG32588-RA 1..673 1..673 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:07:52 Download gff for AT31812.complete
Subject Subject Range Query Range Percent Splice Strand
CG32588-RA 1..677 1..677 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:15:43 Download gff for AT31812.complete
Subject Subject Range Query Range Percent Splice Strand
CG32588-RA 1..673 1..673 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:32:41 Download gff for AT31812.complete
Subject Subject Range Query Range Percent Splice Strand
CG32588-RA 1..677 1..677 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:31:19 Download gff for AT31812.complete
Subject Subject Range Query Range Percent Splice Strand
X 15206169..15206318 244..393 99 <- Minus
X 15206394..15206636 1..243 100   Minus
X 15205807..15206090 394..677 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:31:19 Download gff for AT31812.complete
Subject Subject Range Query Range Percent Splice Strand
X 15206169..15206318 244..393 99 <- Minus
X 15206394..15206636 1..243 100   Minus
X 15205807..15206090 394..677 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:31:19 Download gff for AT31812.complete
Subject Subject Range Query Range Percent Splice Strand
X 15206169..15206318 244..393 99 <- Minus
X 15206394..15206636 1..243 100   Minus
X 15205807..15206090 394..677 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:07:52 Download gff for AT31812.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 15100202..15100351 244..393 99 <- Minus
arm_X 15099840..15100123 394..677 100 <- Minus
arm_X 15100427..15100669 1..243 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:51:36 Download gff for AT31812.complete
Subject Subject Range Query Range Percent Splice Strand
X 15213905..15214188 394..677 100 <- Minus
X 15214267..15214416 244..393 99 <- Minus
X 15214492..15214734 1..243 100   Minus

AT31812.pep Sequence

Translation from 81 to 593

> AT31812.pep
MTFFEQISDHFCRVVHTNLKIPLSCCERRINWKISKSIDLLVFFYTLNIG
VLRLLINFIDFMIVFFGWPSNLLILKDFNSRRFRALTHFLLVRAYMLMIY
SIVFITPHKNNIFVPLFAIIMTIDVYVIKLDMKRRGLMPLERSVPPLWEI
LISLCCVVAGQWLLKYLIFH*

AT31812.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 21:59:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19426-PA 206 GG19426-PA 1..194 1..168 167 31.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:39:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG32588-PA 170 CG32588-PA 1..170 1..170 895 100 Plus
CG43075-PA 174 CG43075-PA 1..172 1..168 496 56.1 Plus
CG33252-PA 174 CG33252-PA 1..173 1..169 420 52.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 21:59:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11999-PA 174 GM11999-PA 1..169 1..165 433 51.8 Plus
Dsec\GM11997-PA 174 GM11997-PA 1..169 1..165 418 50.6 Plus
Dsec\GM13355-PA 162 GM13355-PA 1..157 1..165 286 41.8 Plus
Dsec\GM13356-PA 162 GM13356-PA 1..157 1..165 286 41.8 Plus
Dsec\GM13354-PA 162 GM13354-PA 1..157 1..165 286 41.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 21:59:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15816-PA 172 GD15816-PA 1..169 1..165 424 51.2 Plus
Dsim\GD24501-PA 174 GD24501-PA 1..172 1..168 413 50.9 Plus
Dsim\GD24640-PA 161 GD24640-PA 1..157 1..165 261 39.4 Plus
Dsim\GD15713-PA 162 GD15713-PA 1..149 1..157 242 38.5 Plus
Dsim\GD15714-PA 155 GD15714-PA 1..128 1..135 227 41 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 21:59:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16063-PA 180 GE16063-PA 1..177 1..168 261 37 Plus
Dyak\GE16065-PA 180 GE16065-PA 1..177 1..168 254 37.6 Plus

AT31812.hyp Sequence

Translation from 81 to 593

> AT31812.hyp
MTFFEQISDHFCRVVHTNLKIPLSCCERRINWKISKSIDLLVFFYTLNIG
VLRLLINFIDFMIVFFGWPSNLLILKDFNSRRFRALTHFLLVRAYMLMIY
SIVFITPHKNNIFVPLFAIIMTIDVYVIKLDMKRRGLMPLERSVPPLWEI
LISLCCVVAGQWLLKYLIFH*

AT31812.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:27:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG32588-PA 170 CG32588-PA 1..170 1..170 895 100 Plus
CG43075-PA 174 CG43075-PA 1..172 1..168 496 56.1 Plus
CG33252-PA 174 CG33252-PA 1..173 1..169 420 52.3 Plus