Clone AT31918 Report

Search the DGRC for AT31918

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:319
Well:18
Vector:pOTB7
Associated Gene/TranscriptCG13029-RB
Protein status:AT31918.pep: wuzgold
Preliminary Size:363
Sequenced Size:1178

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13029 2002-01-01 Sim4 clustering to Release 2
CG13029 2003-01-01 Sim4 clustering to Release 3
CG13029 2003-01-22 Blastp of sequenced clone
CG13029 2008-04-29 Release 5.5 accounting
CG13029 2008-08-15 Release 5.9 accounting
CG13029 2008-12-18 5.12 accounting

Clone Sequence Records

AT31918.complete Sequence

1178 bp (1178 high quality bases) assembled on 2003-01-22

GenBank Submission: AY075310

> AT31918.complete
CTAATTTCGAAAGAAGCCTTGGAATTACACATAAAACTCATAATTCTTAC
TACAGCTTGTATCTTTTATATAACCATGTGCTTCATGATGATAGGATGCA
AGTACATTGCCAACGCCAATCCGAAGCGGTTCGCAAAGATCGTACATCCC
AGCGCAGTGGGATTCGTTCTAGTGGGAACGGTATTATTTTTTTCGGTGGA
AATGTTCTATATGTTGCCCAGGATATACGACACCGATGGACTGTTCTTCA
AGATCGCCTGGCTTATGGCACTATTTATTGTCTACAATCTGCTAGGAAAT
ATGCTAGCCTGCCATCGCAACTCCTCGGCGGTGACTTCCTTGCCCAAGGA
TCGCCAGATTCCGTGCCCAGAGGAGAAGCACCTGTGGCACTTCTGTGACC
ACTGCCAGATGTTAGTGCCGGTAAAGTATTTGCCATAGAATATTTCTGTA
TATCCACGAAAAAGCATTTGTAAAAAGTGGATGTGCGGATACTAAACATT
ATTACAAAATATGTATGTGACACTTAATACAGCCCAGATCCTGGCACTGC
AAAGTGTGTGAATGCTGCATTCTGAGGCGGGATCATCACTGCATCTTCAC
TGCGACTTGCGTTGGCCACACTAATTACAGGTACTTTTTCTGGTTCACAG
TTTACATGCATATTGGATCACTTTTGTCATTGGCAACGCATGTAAATCTG
CTTATAATTGATGAACAAATTCGGAGGCAATATGTTGTATTACACTTTTC
ACGCTTTTTCCTATTTCTCAAACCAATGAGCTGCGAGTTAATAGCACTGA
ACATAAGTTTCATCATCAACATCTATGCCTGCATTCTATCACTCATAATG
TTGGGATATCAGATACCAGCATTGTATCTGAATACCACATTCTATACGCC
AAAGGATTATAGATACAATCAAGGGCTACTGGGCAACTTCATGGCCTTCA
TGGGAAAACGAGGCCTCTGGACATTTATTTCGCCCAGCATTAGGAGTCCT
CTGCCCCACGATGGAACTAAGTGGCAAACCAAACAGGCACCCACTACTTT
TTGATAGCACCAACCATTATCCAAAAAATGTACTGTGTATTTAGGAACTT
TCCGAAATGATTACCAGTAAAAAAAAAGAATATTTCAGATATTTATAAAT
AAAACTTCTAAAAAAAAAAAAAAAAAAA

AT31918.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:52:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG13029-RB 1159 CG13029-RB 1..1159 1..1159 5795 100 Plus
CG13029-RC 1072 CG13029-RC 439..1072 532..1165 3170 100 Plus
CG13029-RC 1072 CG13029-RC 20..439 1..420 2100 100 Plus
CG17197-RB 1575 CG17197-RB 437..549 536..648 280 83.1 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:03:28
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 16850115..16850747 1..633 3165 100 Plus
chr3L 24539361 chr3L 16850801..16851330 629..1159 2515 98.7 Plus
chr3R 27901430 chr3R 21597803..21597915 648..536 280 83.2 Minus
chr3R 27901430 chr3R 21598739..21598845 643..537 205 79.4 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:04:15 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:03:26
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16860622..16861254 1..633 3165 100 Plus
3L 28110227 3L 16861308..16861844 629..1165 2685 100 Plus
3R 32079331 3R 25774821..25774933 648..536 280 83.2 Minus
3R 32079331 3R 25775757..25775863 643..537 205 79.4 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:12:10
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 16853722..16854354 1..633 3165 100 Plus
3L 28103327 3L 16854408..16854944 629..1165 2685 100 Plus
3R 31820162 3R 25515652..25515764 648..536 280 83.1 Minus
3R 31820162 3R 25516588..25516694 643..537 205 79.4 Minus
Blast to na_te.dros performed on 2019-03-16 02:03:26 has no hits.

AT31918.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:04:09 Download gff for AT31918.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 16850115..16850744 1..630 100 -> Plus
chr3L 16850803..16851330 631..1159 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:33:12 Download gff for AT31918.complete
Subject Subject Range Query Range Percent Splice Strand
CG13029-RC 1..336 76..411 100 == Plus
CG13029-RC 337..867 524..1054 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:49:16 Download gff for AT31918.complete
Subject Subject Range Query Range Percent Splice Strand
CG13029-RC 1..336 76..411 100 == Plus
CG13029-RC 337..867 524..1054 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:14:44 Download gff for AT31918.complete
Subject Subject Range Query Range Percent Splice Strand
CG13029-RC 1..336 76..411 100 == Plus
CG13029-RC 337..867 524..1054 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:31:18 Download gff for AT31918.complete
Subject Subject Range Query Range Percent Splice Strand
CG13029-RC 1..336 76..411 100 == Plus
CG13029-RC 337..867 524..1054 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:57:08 Download gff for AT31918.complete
Subject Subject Range Query Range Percent Splice Strand
CG13029-RC 337..867 524..1054 99   Plus
CG13029-RC 1..336 76..411 100 == Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:59:39 Download gff for AT31918.complete
Subject Subject Range Query Range Percent Splice Strand
CG13029-RB 1..1159 1..1159 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:49:16 Download gff for AT31918.complete
Subject Subject Range Query Range Percent Splice Strand
CG13029-RB 1..1159 1..1159 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:14:44 Download gff for AT31918.complete
Subject Subject Range Query Range Percent Splice Strand
CG13029-RC 1..411 1..411 100 == Plus
CG13029-RC 412..1047 524..1159 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:31:18 Download gff for AT31918.complete
Subject Subject Range Query Range Percent Splice Strand
CG13029-RB 1..1159 1..1159 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:57:08 Download gff for AT31918.complete
Subject Subject Range Query Range Percent Splice Strand
CG13029-RC 1..411 1..411 100 == Plus
CG13029-RC 412..1047 524..1159 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:04:09 Download gff for AT31918.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16860622..16861251 1..630 100 -> Plus
3L 16861310..16861838 631..1159 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:04:09 Download gff for AT31918.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16860622..16861251 1..630 100 -> Plus
3L 16861310..16861838 631..1159 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:04:09 Download gff for AT31918.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16860622..16861251 1..630 100 -> Plus
3L 16861310..16861838 631..1159 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:14:44 Download gff for AT31918.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16853722..16854351 1..630 100 -> Plus
arm_3L 16854410..16854938 631..1159 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:10:18 Download gff for AT31918.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16853722..16854351 1..630 100 -> Plus
3L 16854410..16854938 631..1159 100   Plus

AT31918.hyp Sequence

Translation from 1 to 437

> AT31918.hyp
LISKEALELHIKLIILTTACIFYITMCFMMIGCKYIANANPKRFAKIVHP
SAVGFVLVGTVLFFSVEMFYMLPRIYDTDGLFFKIAWLMALFIVYNLLGN
MLACHRNSSAVTSLPKDRQIPCPEEKHLWHFCDHCQMLVPVKYLP*

AT31918.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:28:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG13029-PC 288 CG13029-PC 1..115 26..140 631 100 Plus
CG17197-PB 290 CG17197-PB 1..115 26..140 372 53.9 Plus
CG17196-PA 276 CG17196-PA 1..113 26..140 312 49.6 Plus
CG17195-PA 283 CG17195-PA 1..111 26..138 303 45.1 Plus
CG17196-PC 253 CG17196-PC 1..90 26..140 224 40 Plus

AT31918.pep Sequence

Translation from 75 to 437

> AT31918.pep
MCFMMIGCKYIANANPKRFAKIVHPSAVGFVLVGTVLFFSVEMFYMLPRI
YDTDGLFFKIAWLMALFIVYNLLGNMLACHRNSSAVTSLPKDRQIPCPEE
KHLWHFCDHCQMLVPVKYLP*

AT31918.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:51:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19937-PA 305 GF19937-PA 1..115 1..115 328 47.8 Plus
Dana\GF23940-PA 185 GF23940-PA 1..115 1..115 258 38.3 Plus
Dana\GF18232-PA 295 GF18232-PA 23..116 22..115 210 47.4 Plus
Dana\GF23939-PA 259 GF23939-PA 1..73 43..115 207 46.6 Plus
Dana\GF24551-PA 209 GF24551-PA 3..55 63..115 147 47.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:51:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13586-PA 288 GG13586-PA 1..117 1..117 526 80.3 Plus
Dere\GG12221-PA 281 GG12221-PA 1..115 1..115 345 52.2 Plus
Dere\GG12220-PA 278 GG12220-PA 1..113 1..115 300 47.8 Plus
Dere\GG12218-PA 283 GG12218-PA 1..113 1..115 299 47.8 Plus
Dere\GG12217-PA 302 GG12217-PA 36..133 18..115 194 37.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:51:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH25236-PA 308 GH25236-PA 23..120 18..115 221 42.9 Plus
Dgri\GH23419-PA 308 GH23419-PA 23..120 18..115 220 42.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:05:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG13029-PC 288 CG13029-PC 1..115 1..115 631 100 Plus
CG17197-PB 290 CG17197-PB 1..115 1..115 372 53.9 Plus
CG17196-PA 276 CG17196-PA 1..113 1..115 312 49.6 Plus
CG17195-PA 283 CG17195-PA 1..111 1..113 303 45.1 Plus
CG17196-PC 253 CG17196-PC 1..90 1..115 224 40 Plus
CG17196-PB 251 CG17196-PB 1..88 1..115 222 42.6 Plus
CG4956-PA 302 CG4956-PA 40..133 22..115 204 44.2 Plus
CG17198-PB 299 CG17198-PB 49..126 36..115 153 40.7 Plus
CG17198-PA 299 CG17198-PA 49..126 36..115 153 40.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:51:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10345-PA 308 GI10345-PA 22..119 18..115 213 39.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:51:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22296-PA 270 GL22296-PA 20..120 17..117 202 38.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:51:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18553-PB 302 GA18553-PB 18..130 2..115 199 35.7 Plus
Dpse\GA10260-PB 256 GA10260-PB 2..111 9..117 147 31.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:51:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25666-PA 288 GM25666-PA 1..117 1..117 583 90.6 Plus
Dsec\GM10221-PA 288 GM10221-PA 1..115 1..115 332 55.7 Plus
Dsec\GM10220-PA 276 GM10220-PA 1..113 1..115 304 50.4 Plus
Dsec\GM10219-PA 283 GM10219-PA 1..111 1..113 292 45.1 Plus
Dsec\GM10218-PA 302 GM10218-PA 18..133 1..115 192 35.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:51:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14673-PA 288 GD14673-PA 1..115 1..115 571 90.4 Plus
Dsim\GD18171-PA 276 GD18171-PA 1..113 1..115 302 49.6 Plus
Dsim\GD18170-PA 283 GD18170-PA 1..111 1..113 287 45.1 Plus
Dsim\GD18169-PA 302 GD18169-PA 40..133 22..115 181 37.2 Plus
Dsim\GD18172-PA 300 GD18172-PA 50..127 36..115 151 42 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:51:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10196-PA 321 GJ10196-PA 33..132 18..117 256 47 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:51:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18990-PA 278 GK18990-PA 11..104 22..115 166 33 Plus
Dwil\GK18989-PA 273 GK18989-PA 14..101 31..117 150 31.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:51:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19883-PA 288 GE19883-PA 1..117 1..117 540 83.8 Plus
Dyak\GE10668-PA 276 GE10668-PA 1..115 1..115 345 49.6 Plus
Dyak\GE10667-PA 276 GE10667-PA 1..113 1..115 304 49.6 Plus
Dyak\GE10666-PA 283 GE10666-PA 1..113 1..115 292 47 Plus
Dyak\GE10664-PA 302 GE10664-PA 40..133 22..115 186 38.3 Plus