Clone BO03049 Report

Search the DGRC for BO03049

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:30
Well:49
Vector:pDNR-Dual
Associated Gene/TranscriptCG13315-RA
Protein status:BO03049.pep: Imported from assembly
Sequenced Size:242

Clone Sequence Records

BO03049.5prime Sequence

240 bp (239 high quality bases) assembled on 2005-11-30

> BO03049.5prime
GAAGTTATCAGTCGACATGTCTGCCACTAAGGTGAACCATTTGATCGGAG
CGACTACGCGCTACATTGCCGGACGGAATGCGGTGCAGACGGTCTACTGG
CGCACCTCAGCCGGACCCAATCCCCGGATGCTGAAGACCAACAAGCTGCA
GAACTTCGATCGCACCCAGAAGGCGCCTCAGAGTGTACGGATGCAGAACT
ATGATCGCAGCTATATCCGTGATAAGAAGCTTTCTAGACC

BO03049.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:45:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG13315-PA 210 CG13315-RA 1..207 17..223 1035 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 00:52:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG13315-RB 498 CG13315-RB 135..341 17..223 1035 100 Plus
CG13315-RA 618 CG13315-RA 135..341 17..223 1035 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 00:51:56
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 9097011..9097217 17..223 1035 100 Plus
Blast to na_te.dros performed on 2015-02-12 00:51:59 has no hits.

BO03049.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:39:00 Download gff for BO03049.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13315-PA 1..210 17..226 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:41:04 Download gff for BO03049.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13315-PA 1..210 17..226 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 11:34:24 Download gff for BO03049.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13315-RA 135..349 17..232 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 02:16:11 Download gff for BO03049.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13315-RA 135..349 17..232 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 02:16:11 Download gff for BO03049.5prime
Subject Subject Range Query Range Percent Splice Strand
3L 9097011..9097225 17..232 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 11:34:24 Download gff for BO03049.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 9090111..9090325 17..232 98   Plus

BO03049.3prime Sequence

240 bp (239 high quality bases) assembled on 2005-11-30

> BO03049.3prime
ATGGTCTAGAAAGCTTCTTATCACGGATATAGCTGCGATCATAGTTCTGC
ATCCGTACACTCTGAGGCGCCTTCTGGGTGCGATCGAAGTTCTGCAGCTT
GTTGGTCTTCAGCATCCGGGGATTGGGTCCGGCTGAGGTGCGCCAGTAGA
CCGTCTGCACCGCATTCCGTCCGGCAATGTAGCGCGTAGTCGCTCCGATC
AAATGGTTCACCTTAGTGGCAGACATGTCGACTGATAACT

BO03049.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:45:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG13315-PA 210 CG13315-RA 1..207 226..20 1035 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 14:56:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG13315-RB 498 CG13315-RB 135..341 226..20 1035 100 Minus
CG13315-RA 618 CG13315-RA 135..341 226..20 1035 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 14:56:21
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 9097011..9097217 226..20 1035 100 Minus
Blast to na_te.dros performed on 2015-02-13 14:56:22 has no hits.

BO03049.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:38:59 Download gff for BO03049.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13315-PA 1..210 17..226 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:41:03 Download gff for BO03049.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13315-PA 1..210 17..226 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-03 10:58:27 Download gff for BO03049.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13315-RA 135..349 11..226 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 16:39:33 Download gff for BO03049.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13315-RA 135..349 11..226 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 16:39:33 Download gff for BO03049.3prime
Subject Subject Range Query Range Percent Splice Strand
3L 9097011..9097225 11..226 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-03 10:58:27 Download gff for BO03049.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 9090111..9090325 11..226 98   Minus

BO03049.complete Sequence

242 bp assembled on 2011-06-28

> BO03049.complete
GAAGTTATCAGTCGACATGTCTGCCACTAAGGTGAACCATTTGATCGGAG
CGACTACGCGCTACATTGCCGGACGGAATGCGGTGCAGACGGTCTACTGG
CGCACCTCAGCCGGACCCAATCCCCGGATGCTGAAGACCAACAAGCTGCA
GAACTTCGATCGCACCCAGAAGGCGCCTCAGAGTGTACGGATGCAGAACT
ATGATCGCAGCTATATCCGTGATAAGAAGCTTTCTAGACCAT

BO03049.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:00:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG13315-RB 210 CG13315-PB 1..207 17..223 1035 100 Plus
CG13315-RA 210 CG13315-PA 1..207 17..223 1035 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:00:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG13315-RB 498 CG13315-RB 135..341 17..223 1035 100 Plus
CG13315-RA 618 CG13315-RA 135..341 17..223 1035 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:00:30
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 9097011..9097217 17..223 1035 100 Plus
Blast to na_te.dros performed on 2014-11-26 16:00:31 has no hits.

BO03049.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-06-28 12:15:52 Download gff for BO03049.complete
Subject Subject Range Query Range Percent Splice Strand
CG13315-RA 136..345 17..226 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:50:00 Download gff for BO03049.complete
Subject Subject Range Query Range Percent Splice Strand
CG13315-RA 135..344 17..226 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:09:03 Download gff for BO03049.complete
Subject Subject Range Query Range Percent Splice Strand
CG13315-RA 135..344 17..226 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:09:03 Download gff for BO03049.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9097011..9097220 17..226 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:50:00 Download gff for BO03049.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 9090111..9090320 17..226 99   Plus

BO03049.pep Sequence

Translation from 16 to 241

> BO03049.pep
MSATKVNHLIGATTRYIAGRNAVQTVYWRTSAGPNPRMLKTNKLQNFDRT
QKAPQSVRMQNYDRSYIRDKKLSRP

BO03049.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:49:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG13315-PB 69 CG13315-PB 1..69 1..69 361 100 Plus
CG13315-PA 69 CG13315-PA 1..69 1..69 361 100 Plus