Clone BO03471 Report

Search the DGRC for BO03471

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:34
Well:71
Vector:pDNR-Dual
Associated Gene/TranscriptRoc1a-RA
Protein status:BO03471.pep: Imported from assembly
Sequenced Size:359

Clone Sequence Records

BO03471.3prime Sequence

357 bp (356 high quality bases) assembled on 2005-11-30

> BO03471.3prime
ATGGTCTAGAAAGCTTTTTGTGGCCGTACTTCTGGAAATCCCACTCGCGG
TTGTCCAGTGGGCATACCTGGCGCGTCTTTAGCCAGCGAGAGATGCAGTG
GAAATGGAAGGCGTGGTTGCAGACGCCCCAGGCCACGGTGCACTCCTCGC
TAGTGGCGGACGCCTGGTTCGCCTGACACTCGATGCACAAGTCCATGATG
TGGTTGCGGCAGATGGCGCAGTTGTCCACCACGATGTCCCAGGCCCACAG
AGCCACGGCGTTCCACTTCTTCACCTCAAAGCGCTTCTTATCGCCCTTGC
TGCTGCTGGAGGGAACCTCGTATCCATCCTCGTCGACTTCCATGTCGACT
GATAACT

BO03471.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:49:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG16982-PA 327 Roc1a-RA 1..324 343..20 1620 100 Minus
CG16988-PA 369 Roc1b-RA 160..219 229..170 175 91.6 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 02:16:51
Subject Length Description Subject Range Query Range Score Percent Strand
Roc1a-RD 1145 CG16982-RD 144..473 344..15 1635 99.7 Minus
Roc1a-RA 696 CG16982-RA 144..473 344..15 1635 99.7 Minus
Roc1a-RC 1229 CG16982-RC 305..557 267..15 1250 99.6 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 02:16:49
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 647702..647925 238..15 1105 99.6 Minus
3L 28110227 3L 358134..358394 285..22 430 78.4 Minus
X 23542271 X 647447..647525 344..266 395 100 Minus
Blast to na_te.dros performed 2015-02-11 02:16:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dbif\P-element_O 2986 Dbif\P-element_O P_O 2986bp Derived from X71634. 2227..2273 239..195 104 72.3 Minus

BO03471.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:43:33 Download gff for BO03471.3prime
Subject Subject Range Query Range Percent Splice Strand
Roc1a-PA 1..327 17..343 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:47:42 Download gff for BO03471.3prime
Subject Subject Range Query Range Percent Splice Strand
CG16982-PA 1..327 17..343 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-22 20:45:16 Download gff for BO03471.3prime
Subject Subject Range Query Range Percent Splice Strand
Roc1a-RA 139..476 12..348 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 05:23:03 Download gff for BO03471.3prime
Subject Subject Range Query Range Percent Splice Strand
Roc1a-RA 139..476 12..348 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 05:23:03 Download gff for BO03471.3prime
Subject Subject Range Query Range Percent Splice Strand
X 647442..647525 266..348 97 -> Minus
X 647610..647637 238..265 100 -> Minus
X 647703..647928 12..237 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-22 20:45:16 Download gff for BO03471.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 541475..541558 266..348 97 -> Minus
arm_X 541643..541670 238..265 100 -> Minus
arm_X 541736..541961 12..237 99   Minus

BO03471.5prime Sequence

357 bp (356 high quality bases) assembled on 2005-11-30

> BO03471.5prime
GAAGTTATCAGTCGACATGGAAGTCGACGAGGATGGATACGAGGTTCCCT
CCAGCAGCAGCAAGGGCGATAAGAAGCGCTTTGAGGTGAAGAAGTGGAAC
GCCGTGGCTCTGTGGGCCTGGGACATCGTGGTGGACAACTGCGCCATCTG
CCGCAACCACATCATGGACTTGTGCATCGAGTGTCAGGCGAACCAGGCGT
CCGCCACTAGCGAGGAGTGCACCGTGGCCTGGGGCGTCTGCAACCACGCC
TTCCATTTCCACTGCATCTCTCGCTGGCTAAAGACGCGCCAGGTATGCCC
ACTGGACAACCGCGAGTGGGATTTCCAGAAGTACGGCCACAAAAAGCTTT
CTAGACC

BO03471.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:49:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG16982-PA 327 Roc1a-RA 1..324 17..340 1620 100 Plus
CG16988-PA 369 Roc1b-RA 160..219 131..190 175 91.6 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 00:54:57
Subject Length Description Subject Range Query Range Score Percent Strand
Roc1a-RD 1145 CG16982-RD 144..473 16..345 1635 99.7 Plus
Roc1a-RA 696 CG16982-RA 144..473 16..345 1635 99.7 Plus
Roc1a-RC 1229 CG16982-RC 305..557 93..345 1250 99.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 00:54:52
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 647702..647925 122..345 1105 99.6 Plus
3L 28110227 3L 358134..358394 75..338 430 78.4 Plus
X 23542271 X 647447..647525 16..94 395 100 Plus
Blast to na_te.dros performed 2015-02-12 00:54:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dbif\P-element_O 2986 Dbif\P-element_O P_O 2986bp Derived from X71634. 2227..2273 121..165 104 72.3 Plus

BO03471.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:43:34 Download gff for BO03471.5prime
Subject Subject Range Query Range Percent Splice Strand
Roc1a-PA 1..327 17..343 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:47:44 Download gff for BO03471.5prime
Subject Subject Range Query Range Percent Splice Strand
CG16982-PA 1..327 17..343 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 11:35:00 Download gff for BO03471.5prime
Subject Subject Range Query Range Percent Splice Strand
Roc1a-RA 139..476 12..348 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 02:28:29 Download gff for BO03471.5prime
Subject Subject Range Query Range Percent Splice Strand
Roc1a-RA 139..476 12..348 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 02:28:29 Download gff for BO03471.5prime
Subject Subject Range Query Range Percent Splice Strand
X 647703..647928 123..348 99   Plus
X 647442..647525 12..94 97 -> Plus
X 647610..647637 95..122 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 11:35:00 Download gff for BO03471.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 541475..541558 12..94 97 -> Plus
arm_X 541643..541670 95..122 100 -> Plus
arm_X 541736..541961 123..348 99   Plus

BO03471.complete Sequence

359 bp assembled on 2011-06-28

> BO03471.complete
GAAGTTATCAGTCGACATGGAAGTCGACGAGGATGGATACGAGGTTCCCT
CCAGCAGCAGCAAGGGCGATAAGAAGCGCTTTGAGGTGAAGAAGTGGAAC
GCCGTGGCTCTGTGGGCCTGGGACATCGTGGTGGACAACTGCGCCATCTG
CCGCAACCACATCATGGACTTGTGCATCGAGTGTCAGGCGAACCAGGCGT
CCGCCACTAGCGAGGAGTGCACCGTGGCCTGGGGCGTCTGCAACCACGCC
TTCCATTTCCACTGCATCTCTCGCTGGCTAAAGACGCGCCAGGTATGCCC
ACTGGACAACCGCGAGTGGGATTTCCAGAAGTACGGCCACAAAAAGCTTT
CTAGACCAT

BO03471.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:02:10
Subject Length Description Subject Range Query Range Score Percent Strand
Roc1a-RD 327 CG16982-PD 1..324 17..340 1620 100 Plus
Roc1a-RA 327 CG16982-PA 1..324 17..340 1620 100 Plus
Roc1a-RC 411 CG16982-PC 161..408 93..340 1240 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:02:12
Subject Length Description Subject Range Query Range Score Percent Strand
Roc1a-RD 1145 CG16982-RD 144..473 16..345 1635 99.7 Plus
Roc1a-RA 696 CG16982-RA 144..473 16..345 1635 99.7 Plus
Roc1a-RC 1229 CG16982-RC 305..557 93..345 1250 99.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:02:08
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 647702..647925 122..345 1105 99.6 Plus
3L 28110227 3L 358134..358394 75..338 430 78.4 Plus
X 23542271 X 647447..647525 16..94 395 100 Plus
Blast to na_te.dros performed 2014-11-26 16:02:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dbif\P-element_O 2986 Dbif\P-element_O P_O 2986bp Derived from X71634. 2227..2273 121..165 104 72.3 Plus

BO03471.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-06-28 12:15:56 Download gff for BO03471.complete
Subject Subject Range Query Range Percent Splice Strand
Roc1a-RA 162..485 17..340 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:50:44 Download gff for BO03471.complete
Subject Subject Range Query Range Percent Splice Strand
Roc1a-RA 145..468 17..340 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:09:45 Download gff for BO03471.complete
Subject Subject Range Query Range Percent Splice Strand
Roc1a-RA 145..468 17..340 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:09:45 Download gff for BO03471.complete
Subject Subject Range Query Range Percent Splice Strand
X 647610..647637 95..122 100 -> Plus
X 647703..647920 123..340 100   Plus
X 647448..647525 17..94 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:50:44 Download gff for BO03471.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 541481..541558 17..94 100 -> Plus
arm_X 541643..541670 95..122 100 -> Plus
arm_X 541736..541953 123..340 100   Plus

BO03471.pep Sequence

Translation from 16 to 358

> BO03471.pep
MEVDEDGYEVPSSSSKGDKKRFEVKKWNAVALWAWDIVVDNCAICRNHIM
DLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNRE
WDFQKYGHKKLSRP

BO03471.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:51:07
Subject Length Description Subject Range Query Range Score Percent Strand
Roc1a-PD 108 CG16982-PD 1..108 1..108 619 100 Plus
Roc1a-PA 108 CG16982-PA 1..108 1..108 619 100 Plus
Roc1a-PC 136 CG16982-PC 1..136 1..108 580 79.4 Plus
Roc1b-PA 122 CG16988-PA 21..121 9..107 395 67.6 Plus
Roc2-PB 113 CG8998-PB 6..112 5..107 274 43.9 Plus