Clone BO04049 Report

Search the DGRC for BO04049

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:40
Well:49
Vector:pDNR-Dual
Associated Gene/TranscriptAtg8a-RA
Protein status:BO04049.pep: validated full length
Sequenced Size:397

Clone Sequence Records

BO04049.3prime Sequence

395 bp (394 high quality bases) assembled on 2005-12-01

> BO04049.3prime
ATGGTCTAGAAAGCTTGCGTTAATTTTGGCCATGCCGTAAACATTCTCAT
CGGAGTAGGCAATGTACAGGAAATAGTCCTCCTCGTGATGTTCCTGGTAC
AGGGAGCCCATGGTAGCCGATGTTGGTGGAATGACGTTGTTCACAAAGAA
GAAGAGGGCATCCTCGGGACGCAGGTGGATGCGCTTGCGAATGAGGAAGT
AGAACTGACCGACGGTCAGGTCGGAAGGCACCAGGTACTTCTTCTTGTCC
AAATCACCGATGCGCGCCTTGGGAGCCTTCTCGACGATGACGGGCACACG
GTCTGGATATTTGCGACGGATCTTGTCGCCCTCGGCGCGACGCTTCTCGA
AGGCGTGCTCCTCCTTGTATTGGAACTTCATGTCGACTGATAACT

BO04049.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:57:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG32672-PA 366 Atg8a-RA 1..363 381..19 1815 100 Minus
CG12334-PA 363 Atg8b-RA 58..104 330..284 160 93.6 Minus
CG12334-PA 363 Atg8b-RA 181..281 207..107 155 86.1 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 05:27:45
Subject Length Description Subject Range Query Range Score Percent Strand
Atg8a-RA 1214 CG32672-RA 268..631 382..19 1820 100 Minus
Atg8a-RC 1183 CG32672-RC 328..600 291..19 1365 100 Minus
Atg8a-RB 1010 CG32672-RB 155..427 291..19 1365 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 05:27:44
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 10765604..10765802 93..291 995 100 Plus
3R 32079331 3R 17724567..17724904 44..381 775 82 Plus
X 23542271 X 10767979..10768071 290..382 465 100 Plus
X 23542271 X 10765461..10765537 19..95 385 100 Plus
Blast to na_te.dros performed 2015-02-13 05:27:44
Subject Length Description Subject Range Query Range Score Percent Strand
412 7567 412 412 7567bp 5841..5904 383..321 110 69.7 Minus

BO04049.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:53:18 Download gff for BO04049.3prime
Subject Subject Range Query Range Percent Splice Strand
Atg8a-PA 1..366 15..381 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 00:01:50 Download gff for BO04049.3prime
Subject Subject Range Query Range Percent Splice Strand
CG32672-PA 1..366 15..381 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-01 17:52:44 Download gff for BO04049.3prime
Subject Subject Range Query Range Percent Splice Strand
Atg8a-RA 255..635 10..390 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 07:59:22 Download gff for BO04049.3prime
Subject Subject Range Query Range Percent Splice Strand
Atg8a-RA 258..638 10..390 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 07:59:22 Download gff for BO04049.3prime
Subject Subject Range Query Range Percent Splice Strand
X 10765454..10765535 10..93 96 <- Plus
X 10765605..10765802 94..291 100 <- Plus
X 10767981..10768081 292..390 96   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-01 17:52:44 Download gff for BO04049.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 10662014..10662114 292..390 96   Plus
arm_X 10659487..10659568 10..93 96 <- Plus
arm_X 10659638..10659835 94..291 100 <- Plus

BO04049.5prime Sequence

395 bp (395 high quality bases) assembled on 2006-02-03

> BO04049.5prime
GAAGTTATCAGTCGACATGAAGTTCCAATACAAGGAGGAGCACGCCTTCG
AGAAGCGTCGCGCCGAGGGCGACAAGATCCGTCGCAAATATCCAGACCGT
GTGCCCGTCATCGTCGAGAAGGCTCCCAAGGCGCGCATCGGTGATTTGGA
CAAGAAGAAGTACCTGGTGCCTTCCGACCTGACCGTCGGTCAGTTCTACT
TCCTCATTCGCAAGCGCATCCACCTGCGTCCCGAGGATGCCCTCTTCTTC
TTTGTGAACAACGTCATTCCACCAACATCGGCTACCATGGGCTCCCTGTA
CCAGGAACATCACGAGGAGGACTATTTCCTGTACATTGCCTACTCCGATG
AGAATGTTTACGGCATGGCCAAAATTAACGCAAGCTTTCTAGACC

BO04049.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:57:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG32672-PA 366 Atg8a-RA 1..363 17..379 1815 100 Plus
CG12334-PA 363 Atg8b-RA 58..104 68..114 160 93.6 Plus
CG12334-PA 363 Atg8b-RA 181..281 191..291 155 86.1 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 06:13:53
Subject Length Description Subject Range Query Range Score Percent Strand
Atg8a-RA 1214 CG32672-RA 268..631 16..379 1820 100 Plus
Atg8a-RC 1183 CG32672-RC 328..600 107..379 1365 100 Plus
Atg8a-RB 1010 CG32672-RB 155..427 107..379 1365 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 06:13:46
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 10765604..10765802 305..107 995 100 Minus
3R 32079331 3R 17724567..17724904 354..17 775 82 Minus
X 23542271 X 10767979..10768071 108..16 465 100 Minus
X 23542271 X 10765461..10765537 379..303 385 100 Minus
Blast to na_te.dros performed 2015-02-12 06:13:49
Subject Length Description Subject Range Query Range Score Percent Strand
412 7567 412 412 7567bp 5841..5904 15..77 110 69.7 Plus

BO04049.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:53:19 Download gff for BO04049.5prime
Subject Subject Range Query Range Percent Splice Strand
Atg8a-PA 1..366 17..383 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 00:01:52 Download gff for BO04049.5prime
Subject Subject Range Query Range Percent Splice Strand
CG32672-PA 1..366 17..383 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 05:25:07 Download gff for BO04049.5prime
Subject Subject Range Query Range Percent Splice Strand
Atg8a-RA 255..635 8..388 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 07:52:48 Download gff for BO04049.5prime
Subject Subject Range Query Range Percent Splice Strand
Atg8a-RA 258..638 8..388 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 07:52:48 Download gff for BO04049.5prime
Subject Subject Range Query Range Percent Splice Strand
X 10765454..10765535 305..388 96 <- Minus
X 10765605..10765802 107..304 100 <- Minus
X 10767981..10768081 8..106 96   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 05:25:07 Download gff for BO04049.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 10659487..10659568 305..388 96 <- Minus
arm_X 10659638..10659835 107..304 100 <- Minus
arm_X 10662014..10662114 8..106 96   Minus

BO04049.complete Sequence

397 bp (397 high quality bases) assembled on 2005-10-17

GenBank Submission: FJ629615

> BO04049.complete
GAAGTTATCAGTCGACATGAAGTTCCAATACAAGGAGGAGCACGCCTTCG
AGAAGCGTCGCGCCGAGGGCGACAAGATCCGTCGCAAATATCCAGACCGT
GTGCCCGTCATCGTCGAGAAGGCTCCCAAGGCGCGCATCGGTGATTTGGA
CAAGAAGAAGTACCTGGTGCCTTCCGACCTGACCGTCGGTCAGTTCTACT
TCCTCATTCGCAAGCGCATCCACCTGCGTCCCGAGGATGCCCTCTTCTTC
TTTGTGAACAACGTCATTCCACCAACATCGGCTACCATGGGCTCCCTGTA
CCAGGAACATCACGAGGAGGACTATTTCCTGTACATTGCCTACTCCGATG
AGAATGTTTACGGCATGGCCAAAATTAACGCAAGCTTTCTAGACCAT

BO04049.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:18:22
Subject Length Description Subject Range Query Range Score Percent Strand
Atg8a-RA 366 CG32672-PA 1..363 17..379 1815 100 Plus
Atg8a-RC 324 CG32672-PC 49..321 107..379 1365 100 Plus
Atg8a-RB 291 CG32672-PB 16..288 107..379 1365 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:18:24
Subject Length Description Subject Range Query Range Score Percent Strand
Atg8a-RA 1214 CG32672-RA 268..631 16..379 1820 100 Plus
Atg8a-RC 1183 CG32672-RC 328..600 107..379 1365 100 Plus
Atg8a-RB 1010 CG32672-RB 155..427 107..379 1365 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:18:20
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 10765604..10765802 305..107 995 100 Minus
3R 32079331 3R 17724567..17724904 354..17 775 82 Minus
X 23542271 X 10767979..10768071 108..16 465 100 Minus
X 23542271 X 10765461..10765537 379..303 385 100 Minus
Blast to na_te.dros performed 2014-11-27 16:18:21
Subject Length Description Subject Range Query Range Score Percent Strand
412 7567 412 412 7567bp 5841..5904 15..77 110 69.7 Plus

BO04049.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:33:42 Download gff for BO04049.complete
Subject Subject Range Query Range Percent Splice Strand
Atg8a-RA 1..366 17..383 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:01:07 Download gff for BO04049.complete
Subject Subject Range Query Range Percent Splice Strand
Atg8a-RA 255..635 8..388 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:52:06 Download gff for BO04049.complete
Subject Subject Range Query Range Percent Splice Strand
Atg8a-RA 266..628 17..381 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:33:42 Download gff for BO04049.complete
Subject Subject Range Query Range Percent Splice Strand
Atg8a-RA 255..635 8..388 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:15:32 Download gff for BO04049.complete
Subject Subject Range Query Range Percent Splice Strand
Atg8a-RA 269..631 17..381 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:15:32 Download gff for BO04049.complete
Subject Subject Range Query Range Percent Splice Strand
X 10765459..10765535 305..381 97 <- Minus
X 10765605..10765802 107..304 100 <- Minus
X 10767981..10768070 17..106 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:52:06 Download gff for BO04049.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 10662014..10662103 17..106 100   Minus
arm_X 10659492..10659568 305..381 97 <- Minus
arm_X 10659638..10659835 107..304 100 <- Minus

BO04049.pep Sequence

Translation from 16 to 397

> BO04049.pep
MKFQYKEEHAFEKRRAEGDKIRRKYPDRVPVIVEKAPKARIGDLDKKKYL
VPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHE
EDYFLYIAYSDENVYGMAKINASFLDH

BO04049.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 19:35:39
Subject Length Description Subject Range Query Range Score Percent Strand
Atg8a-PA 121 CG32672-PA 1..121 1..121 638 100 Plus
Atg8b-PB 120 CG12334-PB 3..118 1..116 530 82.8 Plus
Atg8b-PA 120 CG12334-PA 3..118 1..116 530 82.8 Plus
Atg8a-PC 107 CG32672-PC 7..107 21..121 482 92.1 Plus
Atg8a-PB 96 CG32672-PB 6..96 31..121 476 100 Plus