Clone BO04078 Report

Search the DGRC for BO04078

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:40
Well:78
Vector:pDNR-Dual
Associated Gene/TranscriptPaip2-RA
Protein status:BO04078.pep: validated full length
Sequenced Size:406

Clone Sequence Records

BO04078.5prime Sequence

404 bp (404 high quality bases) assembled on 2006-02-03

> BO04078.5prime
GAAGTTATCAGTCGACATGTTGTTAAAAGTGCCATCTGTGGACTGGACGG
ATCAAATAATTTACGTAGTGGACGACGACGAGTCGCTGTCAGACATCGAC
GATGAGCCAGATTTTTCCGAATACATGTGGATGGAGAACGAGGAGGAGTT
CGACAAGAACGAACTGCAACGGCTGGAGGAGGAAGAGATTATGCAGGAGT
GTTTTGAAGCCATGATAGAAGACGAGCTGGAGGAGCAGATCAACGAATGG
GAGAAGGCCAAGACGGACGAGCAGAACACGGCACTTTCCGCACTACCCAA
GAGCCAGTGTGATGTTGAAAAGTCTGTTCTGAATCCGATGGCTGATGAGT
TTGTTCCGCGTTGTCATGTTATAGATTTCCCTGCCTCAGCAAGCTTTCTA
GACC

BO04078.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:58:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG12358-PA 375 Paip2-RA 1..372 17..388 1860 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 02:21:42
Subject Length Description Subject Range Query Range Score Percent Strand
Paip2-RB 1045 CG12358-RB 334..705 17..388 1860 100 Plus
Paip2-RA 1970 CG12358-RA 348..719 17..388 1860 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 02:21:40
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 12983740..12983884 17..161 725 100 Plus
3R 32079331 3R 12984111..12984237 262..388 635 100 Plus
3R 32079331 3R 12983947..12984048 161..262 510 100 Plus
Blast to na_te.dros performed on 2015-02-11 02:21:41 has no hits.

BO04078.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:54:00 Download gff for BO04078.5prime
Subject Subject Range Query Range Percent Splice Strand
Paip2-PA 1..375 17..392 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 00:02:51 Download gff for BO04078.5prime
Subject Subject Range Query Range Percent Splice Strand
CG12358-PA 1..375 17..392 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-22 20:46:21 Download gff for BO04078.5prime
Subject Subject Range Query Range Percent Splice Strand
Paip2-RA 348..725 17..394 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 04:48:08 Download gff for BO04078.5prime
Subject Subject Range Query Range Percent Splice Strand
Paip2-RA 348..725 17..394 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 04:48:08 Download gff for BO04078.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 12983947..12984047 161..261 100 -> Plus
3R 12984111..12984243 262..394 98   Plus
3R 12983735..12983883 11..160 97 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-22 20:46:21 Download gff for BO04078.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 8809457..8809605 11..160 97 -> Plus
arm_3R 8809669..8809769 161..261 100 -> Plus
arm_3R 8809833..8809965 262..394 98   Plus

BO04078.3prime Sequence

404 bp (403 high quality bases) assembled on 2005-12-01

> BO04078.3prime
ATGGTCTAGAAAGCTTGCTGAGGCAGGGAAATCTATAACATGACAACGCG
GAACAAACTCATCAGCCATCGGATTCAGAACAGACTTTTCAACATCACAC
TGGCTCTTGGGTAGTGCGGAAAGTGCCGTGTTCTGCTCGTCCGTCTTGGC
CTTCTCCCATTCGTTGATCTGCTCCTCCAGCTCGTCTTCTATCATGGCTT
CAAAACACTCCTGCATAATCTCTTCCTCCTCCAGCCGTTGCAGTTCGTTC
TTGTCGAACTCCTCCTCGTTCTCCATCCACATGTATTCGGAAAAATCTGG
CTCATCGTCGATGTCTGACAGCGACTCGTCGTCGTCCACTACGTAAATTA
TTTGATCCGTCCAGTCCACAGATGGCACTTTTAACAACATGTCGACTGAT
AACT

BO04078.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:58:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG12358-PA 375 Paip2-RA 1..372 390..19 1860 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 23:03:40
Subject Length Description Subject Range Query Range Score Percent Strand
Paip2-RB 1045 CG12358-RB 334..705 390..19 1860 100 Minus
Paip2-RA 1970 CG12358-RA 348..719 390..19 1860 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 23:03:32
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 12983740..12983884 390..246 725 100 Minus
3R 32079331 3R 12984111..12984237 145..19 635 100 Minus
3R 32079331 3R 12983947..12984048 246..145 510 100 Minus
Blast to na_te.dros performed on 2015-02-11 23:03:36 has no hits.

BO04078.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:53:59 Download gff for BO04078.3prime
Subject Subject Range Query Range Percent Splice Strand
Paip2-PA 1..375 15..390 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 00:02:50 Download gff for BO04078.3prime
Subject Subject Range Query Range Percent Splice Strand
CG12358-PA 1..375 15..390 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 02:35:02 Download gff for BO04078.3prime
Subject Subject Range Query Range Percent Splice Strand
Paip2-RA 348..725 13..390 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 01:23:52 Download gff for BO04078.3prime
Subject Subject Range Query Range Percent Splice Strand
Paip2-RA 348..725 13..390 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 01:23:52 Download gff for BO04078.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 12983735..12983883 247..396 97 -> Minus
3R 12983947..12984047 146..246 100 -> Minus
3R 12984111..12984243 13..145 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 02:35:02 Download gff for BO04078.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 8809457..8809605 247..396 97 -> Minus
arm_3R 8809669..8809769 146..246 100 -> Minus
arm_3R 8809833..8809965 13..145 98   Minus

BO04078.complete Sequence

406 bp (406 high quality bases) assembled on 2005-10-17

GenBank Submission: FJ629631

> BO04078.complete
GAAGTTATCAGTCGACATGTTGTTAAAAGTGCCATCTGTGGACTGGACGG
ATCAAATAATTTACGTAGTGGACGACGACGAGTCGCTGTCAGACATCGAC
GATGAGCCAGATTTTTCCGAATACATGTGGATGGAGAACGAGGAGGAGTT
CGACAAGAACGAACTGCAACGGCTGGAGGAGGAAGAGATTATGCAGGAGT
GTTTTGAAGCCATGATAGAAGACGAGCTGGAGGAGCAGATCAACGAATGG
GAGAAGGCCAAGACGGACGAGCAGAACACGGCACTTTCCGCACTACCCAA
GAGCCAGTGTGATGTTGAAAAGTCTGTTCTGAATCCGATGGCTGATGAGT
TTGTTCCGCGTTGTCATGTTATAGATTTCCCTGCCTCAGCAAGCTTTCTA
GACCAT

BO04078.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 14:42:27
Subject Length Description Subject Range Query Range Score Percent Strand
Paip2-RB 375 CG12358-PB 1..372 17..388 1860 100 Plus
Paip2-RA 375 CG12358-PA 1..372 17..388 1860 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:42:28
Subject Length Description Subject Range Query Range Score Percent Strand
Paip2-RB 1045 CG12358-RB 334..705 17..388 1860 100 Plus
Paip2-RA 1970 CG12358-RA 348..719 17..388 1860 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 14:42:24
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 12983740..12983884 17..161 725 100 Plus
3R 32079331 3R 12984111..12984237 262..388 635 100 Plus
3R 32079331 3R 12983947..12984048 161..262 510 100 Plus
Blast to na_te.dros performed on 2014-11-27 14:42:26 has no hits.

BO04078.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:33:28 Download gff for BO04078.complete
Subject Subject Range Query Range Percent Splice Strand
Paip2-RA 1..375 17..392 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:00:50 Download gff for BO04078.complete
Subject Subject Range Query Range Percent Splice Strand
Paip2-RA 348..725 17..394 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:44:22 Download gff for BO04078.complete
Subject Subject Range Query Range Percent Splice Strand
Paip2-RA 353..719 22..390 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:33:28 Download gff for BO04078.complete
Subject Subject Range Query Range Percent Splice Strand
Paip2-RA 348..725 17..394 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:51:02 Download gff for BO04078.complete
Subject Subject Range Query Range Percent Splice Strand
Paip2-RA 353..719 22..390 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 15:51:02 Download gff for BO04078.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12983745..12983883 22..160 100 -> Plus
3R 12983947..12984047 161..261 100 -> Plus
3R 12984111..12984237 262..390 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:44:22 Download gff for BO04078.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 8809467..8809605 22..160 100 -> Plus
arm_3R 8809669..8809769 161..261 100 -> Plus
arm_3R 8809833..8809959 262..390 98   Plus

BO04078.pep Sequence

Translation from 16 to 406

> BO04078.pep
MLLKVPSVDWTDQIIYVVDDDESLSDIDDEPDFSEYMWMENEEEFDKNEL
QRLEEEEIMQECFEAMIEDELEEQINEWEKAKTDEQNTALSALPKSQCDV
EKSVLNPMADEFVPRCHVIDFPASASFLDH

BO04078.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 19:35:48
Subject Length Description Subject Range Query Range Score Percent Strand
Paip2-PB 124 CG12358-PB 1..124 1..124 656 100 Plus
Paip2-PA 124 CG12358-PA 1..124 1..124 656 100 Plus