Clone BO04223 Report

Search the DGRC for BO04223

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:42
Well:23
Vector:pDNR-Dual
Associated Gene/TranscriptCG12107-RA
Protein status:BO04223.pep:
Sequenced Size:439

Clone Sequence Records

BO04223.5prime Sequence

437 bp (436 high quality bases) assembled on 2005-12-01

> BO04223.5prime
GAAGTTATCAGTCGACATGGCGACGAAAACAAATACCATCGAGCGCAACG
GCCACTCGGCCAAAAGCTCCACACTACGGGAAATTTGCGCGCGCGCCATC
ACAAAATCGGAGTGGGAGGACAAGGAAGAGTTCCTGGACGTTATCTACTG
GTCACGCCAGGTATTCGGCATCTTTCTGGGCGTCATCTGGGGCATTGTTC
CGCTGAAGGGCTTTCTGGGCCTCGTACTATTCGCCGGCATCAGCTGCGGG
ATCGTCTACCTGTACGCCATAAACTTTCAGAACGTGGACGAGGACGCCTA
CGGAGGGGTATGGGAGCTGATCAAGGAGGGGTTCATGACGTCGTTTGCCG
GATTCCTGGTCACGTGGATCATCTTCTACACGGGCCTGCACTACGACGCC
ATAATGGCGGCGAAAGGATCTGCAAGCTTTCTAGACC

BO04223.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:00:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG12107-PA 408 CG12107-RA 1..405 17..421 2000 99.7 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 13:15:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG12107-RA 782 CG12107-RA 103..507 17..421 2010 99.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 13:15:14
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 7674895..7675087 229..421 950 99.5 Plus
2R 25286936 2R 7674552..7674660 17..125 545 100 Plus
2R 25286936 2R 7674719..7674824 123..228 530 100 Plus
Blast to na_te.dros performed on 2015-02-13 13:15:15 has no hits.

BO04223.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:57:09 Download gff for BO04223.5prime
Subject Subject Range Query Range Percent Splice Strand
CG12107-PA 1..408 17..425 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 00:07:28 Download gff for BO04223.5prime
Subject Subject Range Query Range Percent Splice Strand
CG12107-PA 1..408 17..425 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-02 17:40:36 Download gff for BO04223.5prime
Subject Subject Range Query Range Percent Splice Strand
CG12107-RA 99..510 10..425 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 15:48:35 Download gff for BO04223.5prime
Subject Subject Range Query Range Percent Splice Strand
CG12107-RA 99..510 10..425 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 15:48:35 Download gff for BO04223.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 7674548..7674659 10..124 96 -> Plus
2R 7674721..7674824 125..228 100 -> Plus
2R 7674895..7675090 229..425 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-02 17:40:36 Download gff for BO04223.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 3562053..3562164 10..124 96 -> Plus
arm_2R 3562226..3562329 125..228 100 -> Plus
arm_2R 3562400..3562595 229..425 98   Plus

BO04223.3prime Sequence

437 bp (436 high quality bases) assembled on 2005-12-01

> BO04223.3prime
ATGGTCTAGAAAGCTTGCAGATCCTTTCGCCGCCATTATGGCGTCGTAGT
GCAGGCCCGTGTAGAAGATGATCCACGTGACCAGGAATCCGGCAAACGAC
GTCATGAACCCCTCCTTGATCAGCTCCCATACCCCTCCGTAGGCGTCCTC
GTCCACGTTCTGAAAGTTTATGGCGTACAGGTAGACGATCCCGCAGCTGA
TGCCGGCGAATAGTACGAGGCCCAGAAAGCCCTTCAGCGGAACAATGCCC
CAGATGACGCCCAGAAAGATGCCGAATACCTGGCGTGACCAGTAGATAAC
GTCCAGGAACTCTTCCTTGTCCTCCCACTCCGATTTTGTGATGGCGCGCG
CGCAAATTTCCCGTAGTGTGGAGCTTTTGGCCGAGTGGCCGTTGCGCTCG
ATGGTATTTGTTTTCGTCGCCATGTCGACTGATAACT

BO04223.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:00:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG12107-PA 408 CG12107-RA 1..405 423..19 2000 99.7 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 23:48:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG12107-RA 782 CG12107-RA 103..507 423..19 2010 99.8 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 23:48:47
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 7674895..7675087 211..19 950 99.5 Minus
2R 25286936 2R 7674552..7674660 423..315 545 100 Minus
2R 25286936 2R 7674719..7674824 317..212 530 100 Minus
Blast to na_te.dros performed on 2015-02-12 23:48:50 has no hits.

BO04223.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:57:08 Download gff for BO04223.3prime
Subject Subject Range Query Range Percent Splice Strand
CG12107-PA 1..408 15..423 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 00:07:27 Download gff for BO04223.3prime
Subject Subject Range Query Range Percent Splice Strand
CG12107-PA 1..408 15..423 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-31 20:28:41 Download gff for BO04223.3prime
Subject Subject Range Query Range Percent Splice Strand
CG12107-RA 99..510 15..430 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 02:36:47 Download gff for BO04223.3prime
Subject Subject Range Query Range Percent Splice Strand
CG12107-RA 99..510 15..430 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 02:36:47 Download gff for BO04223.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 7674721..7674824 212..315 100 -> Minus
2R 7674895..7675090 15..211 98   Minus
2R 7674548..7674659 316..430 96 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-31 20:28:41 Download gff for BO04223.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 3562226..3562329 212..315 100 -> Minus
arm_2R 3562400..3562595 15..211 98   Minus
arm_2R 3562053..3562164 316..430 96 -> Minus

BO04223.complete Sequence

439 bp assembled on 2007-06-21

GenBank Submission: FJ629676

> BO04223.complete
GAAGTTATCAGTCGACATGGCGACGAAAACAAATACCATCGAGCGCAACG
GCCACTCGGCCAAAAGCTCCACACTACGGGAAATTTGCGCGCGCGCCATC
ACAAAATCGGAGTGGGAGGACAAGGAAGAGTTCCTGGACGTTATCTACTG
GTCACGCCAGGTATTCGGCATCTTTCTGGGCGTCATCTGGGGCATTGTTC
CGCTGAAGGGCTTTCTGGGCCTCGTACTATTCGCCGGCATCAGCTGCGGG
ATCGTCTACCTGTACGCCATAAACTTTCAGAACGTGGACGAGGACGCCTA
CGGAGGGGTATGGGAGCTGATCAAGGAGGGGTTCATGACGTCGTTTGCCG
GATTCCTGGTCACGTGGATCATCTTCTACACGGGCCTGCACTACGACGCC
ATAATGGCGGCGAAAGGATCTGCAAGCTTTCTAGACCAT

BO04223.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:59:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG12107-RA 408 CG12107-PA 1..405 17..421 2010 99.8 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:59:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG12107-RA 782 CG12107-RA 103..507 17..421 2010 99.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 12:59:08
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 7674895..7675087 229..421 950 99.5 Plus
2R 25286936 2R 7674552..7674660 17..125 545 100 Plus
2R 25286936 2R 7674719..7674824 123..228 530 100 Plus
Blast to na_te.dros performed on 2014-11-27 12:59:09 has no hits.

BO04223.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:05:24 Download gff for BO04223.complete
Subject Subject Range Query Range Percent Splice Strand
CG12107-RA 1..408 17..425 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 05:20:18 Download gff for BO04223.complete
Subject Subject Range Query Range Percent Splice Strand
CG12107-RA 96..507 10..425 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:26:02 Download gff for BO04223.complete
Subject Subject Range Query Range Percent Splice Strand
CG12107-RA 103..507 17..423 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:05:24 Download gff for BO04223.complete
Subject Subject Range Query Range Percent Splice Strand
CG12107-RA 96..507 10..425 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:08:38 Download gff for BO04223.complete
Subject Subject Range Query Range Percent Splice Strand
CG12107-RA 103..507 17..423 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:08:38 Download gff for BO04223.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7674895..7675087 229..423 98   Plus
2R 7674552..7674659 17..124 100 -> Plus
2R 7674721..7674824 125..228 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:26:02 Download gff for BO04223.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 3562057..3562164 17..124 100 -> Plus
arm_2R 3562226..3562329 125..228 100 -> Plus
arm_2R 3562400..3562592 229..423 98   Plus

BO04223.pep Sequence

Translation from 16 to 439

> BO04223.pep
MATKTNTIERNGHSAKSSTLREICARAITKSEWEDKEEFLDVIYWSRQVF
GIFLGVIWGIVPLKGFLGLVLFAGISCGIVYLYAINFQNVDEDAYGGVWE
LIKEGFMTSFAGFLVTWIIFYTGLHYDAIMAAKGSASFLDH

BO04223.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 02:38:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG12107-PA 135 CG12107-PA 1..135 1..135 713 100 Plus