Clone BO04224 Report

Search the DGRC for BO04224

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:42
Well:24
Vector:pDNR-Dual
Associated Gene/TranscriptNtf-2-RA
Protein status:BO04224.pep: validated full length
Sequenced Size:424

Clone Sequence Records

BO04224.3prime Sequence

422 bp (421 high quality bases) assembled on 2005-12-01

> BO04224.3prime
ATGGTCTAGAAAGCTTGCGGCAGAGTTGTGGATGTTGAGACGGAAGATGT
CGTGGGCCACAAAGAAGGTGCCTGCGTTGGCCTTCAGGAAAAAGACCTGC
GAGAAGGCATGTGGGGGATCGTCATCGCACTGTAGTCTTCCAAGGACGTT
GATCAGAACTCCGCCATCGAAAGTTGGCTGCGAGTCCACTGTGGTTATCA
CTCTGGTAATCTTCTGAAAGCTCAGACTCTGAACTTTTTCCAGAATCTTG
GGTGCCCCCTGTATTTGGTGGCCTTCAAAGGTCATGAATGAGTCGGTAGC
GCTATAGAAATTAACCACGTTCGCCCGATTCGCCGGGTCATCGAATATCG
CATAGTACTGCTGCACAAATCCCTTGCCAATGTCCTCGTACTGCGGATTC
AGCGACATGTCGACTGATAACT

BO04224.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:00:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG1740-PA 393 Ntf-2-RA 1..390 408..19 1950 100 Minus
CG10174-PA 393 Ntf-2r-RA 1..334 408..75 1120 93.4 Minus
CG10174-PA 393 Ntf-2r-RA 349..390 60..19 160 95.2 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 16:00:22
Subject Length Description Subject Range Query Range Score Percent Strand
Ntf-2-RE 3078 CG1740-RE 146..535 408..19 1950 100 Minus
Ntf-2-RA 755 CG1740-RA 146..535 408..19 1950 100 Minus
Ntf-2r-RA 771 CG10174-RA 119..508 408..19 1515 92.6 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 16:00:20
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18454767..18455156 408..19 1515 92.6 Minus
X 23542271 X 21038743..21038856 132..19 570 100 Minus
X 23542271 X 21035614..21035722 408..300 545 100 Minus
X 23542271 X 21036536..21036637 231..130 510 100 Minus
X 23542271 X 21036399..21036470 300..229 360 100 Minus
Blast to na_te.dros performed on 2015-02-12 16:00:21 has no hits.

BO04224.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:57:10 Download gff for BO04224.3prime
Subject Subject Range Query Range Percent Splice Strand
Ntf-2-PA 1..393 18..408 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 00:07:30 Download gff for BO04224.3prime
Subject Subject Range Query Range Percent Splice Strand
CG1740-PA 1..393 18..408 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-30 15:28:11 Download gff for BO04224.3prime
Subject Subject Range Query Range Percent Splice Strand
Ntf-2-RA 140..535 19..415 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 18:34:23 Download gff for BO04224.3prime
Subject Subject Range Query Range Percent Splice Strand
Ntf-2-RA 140..535 19..415 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 18:34:23 Download gff for BO04224.3prime
Subject Subject Range Query Range Percent Splice Strand
2L 18454767..18455155 20..408 92 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-30 15:28:11 Download gff for BO04224.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 18454767..18455155 20..408 92 <- Minus

BO04224.5prime Sequence

422 bp (421 high quality bases) assembled on 2005-12-01

> BO04224.5prime
GAAGTTATCAGTCGACATGTCGCTGAATCCGCAGTACGAGGACATTGGCA
AGGGATTTGTGCAGCAGTACTATGCGATATTCGATGACCCGGCGAATCGG
GCGAACGTGGTTAATTTCTATAGCGCTACCGACTCATTCATGACCTTTGA
AGGCCACCAAATACAGGGGGCACCCAAGATTCTGGAAAAAGTTCAGAGTC
TGAGCTTTCAGAAGATTACCAGAGTGATAACCACAGTGGACTCGCAGCCA
ACTTTCGATGGCGGAGTTCTGATCAACGTCCTTGGAAGACTACAGTGCGA
TGACGATCCCCCACATGCCTTCTCGCAGGTCTTTTTCCTGAAGGCCAACG
CAGGCACCTTCTTTGTGGCCCACGACATCTTCCGTCTCAACATCCACAAC
TCTGCCGCAAGCTTTCTAGACC

BO04224.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:00:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG1740-PA 393 Ntf-2-RA 1..390 17..406 1950 100 Plus
CG10174-PA 393 Ntf-2r-RA 1..334 17..350 1120 93.4 Plus
CG10174-PA 393 Ntf-2r-RA 349..390 365..406 160 95.2 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-09 18:32:24
Subject Length Description Subject Range Query Range Score Percent Strand
Ntf-2-RE 3078 CG1740-RE 146..535 17..406 1950 100 Plus
Ntf-2-RA 755 CG1740-RA 146..535 17..406 1950 100 Plus
Ntf-2r-RA 771 CG10174-RA 119..508 17..406 1515 92.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-09 18:32:19
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18454767..18455156 17..406 1515 92.6 Plus
X 23542271 X 21038743..21038856 293..406 570 100 Plus
X 23542271 X 21035614..21035722 17..125 545 100 Plus
X 23542271 X 21036536..21036637 194..295 510 100 Plus
X 23542271 X 21036399..21036470 125..196 360 100 Plus
Blast to na_te.dros performed on 2015-02-09 18:32:21 has no hits.

BO04224.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:57:11 Download gff for BO04224.5prime
Subject Subject Range Query Range Percent Splice Strand
Ntf-2-PA 1..393 17..407 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 00:07:31 Download gff for BO04224.5prime
Subject Subject Range Query Range Percent Splice Strand
CG1740-PA 1..393 17..407 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-13 03:58:04 Download gff for BO04224.5prime
Subject Subject Range Query Range Percent Splice Strand
Ntf-2-RA 140..535 10..406 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-09 21:12:18 Download gff for BO04224.5prime
Subject Subject Range Query Range Percent Splice Strand
Ntf-2-RA 140..535 10..406 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-09 21:12:18 Download gff for BO04224.5prime
Subject Subject Range Query Range Percent Splice Strand
2L 18454767..18455155 17..405 92 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-13 03:58:04 Download gff for BO04224.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 18454767..18455155 17..405 92 <- Plus

BO04224.complete Sequence

424 bp (424 high quality bases) assembled on 2005-09-08

GenBank Submission: FJ629677

> BO04224.complete
GAAGTTATCAGTCGACATGTCGCTGAATCCGCAGTACGAGGACATTGGCA
AGGGATTTGTGCAGCAGTACTATGCGATATTCGATGACCCGGCGAATCGG
GCGAACGTGGTTAATTTCTATAGCGCTACCGACTCATTCATGACCTTTGA
AGGCCACCAAATACAGGGGGCACCCAAGATTCTGGAAAAAGTTCAGAGTC
TGAGCTTTCAGAAGATTACCAGAGTGATAACCACAGTGGACTCGCAGCCA
ACTTTCGATGGCGGAGTTCTGATCAACGTCCTTGGAAGACTACAGTGCGA
TGACGATCCCCCACATGCCTTCTCGCAGGTCTTTTTCCTGAAGGCCAACG
CAGGCACCTTCTTTGTGGCCCACGACATCTTCCGTCTCAACATCCACAAC
TCTGCCGCAAGCTTTCTAGACCAT

BO04224.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 08:01:06
Subject Length Description Subject Range Query Range Score Percent Strand
Ntf-2-RE 393 CG1740-PE 1..390 17..406 1950 100 Plus
Ntf-2-RA 393 CG1740-PA 1..390 17..406 1950 100 Plus
Ntf-2r-RA 393 CG10174-PA 1..390 17..406 1515 92.6 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:01:08
Subject Length Description Subject Range Query Range Score Percent Strand
Ntf-2-RE 3078 CG1740-RE 146..535 17..406 1950 100 Plus
Ntf-2-RA 755 CG1740-RA 146..535 17..406 1950 100 Plus
Ntf-2r-RA 771 CG10174-RA 119..508 17..406 1515 92.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 08:01:05
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18454767..18455156 17..406 1515 92.6 Plus
X 23542271 X 21038743..21038856 293..406 570 100 Plus
X 23542271 X 21035614..21035722 17..125 545 100 Plus
X 23542271 X 21036536..21036637 194..295 510 100 Plus
X 23542271 X 21036399..21036470 125..196 360 100 Plus
Blast to na_te.dros performed on 2014-11-27 08:01:05 has no hits.

BO04224.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:41:59 Download gff for BO04224.complete
Subject Subject Range Query Range Percent Splice Strand
Ntf-2-RA 1..393 17..407 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:11:47 Download gff for BO04224.complete
Subject Subject Range Query Range Percent Splice Strand
Ntf-2-RA 135..530 10..406 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:28:25 Download gff for BO04224.complete
Subject Subject Range Query Range Percent Splice Strand
Ntf-2-RA 146..535 17..408 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:41:59 Download gff for BO04224.complete
Subject Subject Range Query Range Percent Splice Strand
Ntf-2-RA 135..530 10..406 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:09:23 Download gff for BO04224.complete
Subject Subject Range Query Range Percent Splice Strand
Ntf-2-RA 146..535 17..408 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 09:09:23 Download gff for BO04224.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18454767..18455156 17..408 92   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:28:25 Download gff for BO04224.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 18454767..18455156 17..408 92   Plus

BO04224.pep Sequence

Translation from 16 to 424

> BO04224.pep
MSLNPQYEDIGKGFVQQYYAIFDDPANRANVVNFYSATDSFMTFEGHQIQ
GAPKILEKVQSLSFQKITRVITTVDSQPTFDGGVLINVLGRLQCDDDPPH
AFSQVFFLKANAGTFFVAHDIFRLNIHNSAASFLDH

BO04224.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 18:49:39
Subject Length Description Subject Range Query Range Score Percent Strand
Ntf-2-PE 130 CG1740-PE 1..130 1..130 680 100 Plus
Ntf-2-PA 130 CG1740-PA 1..130 1..130 680 100 Plus
Ntf-2r-PA 130 CG10174-PA 1..130 1..130 594 87.7 Plus
Ntf-2-PB 129 CG1740-PB 1..128 1..128 591 88.3 Plus
Ntf-2-PC 89 CG1740-PC 1..89 42..130 462 100 Plus