Clone BO04227 Report

Search the DGRC for BO04227

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:42
Well:27
Vector:pDNR-Dual
Associated Gene/Transcript
Protein status:BO04227.pep: validated full length
Sequenced Size:397

Clone Sequence Records

BO04227.3prime Sequence

395 bp (394 high quality bases) assembled on 2005-12-01

> BO04227.3prime
ATGGTCTAGAAAGCTTGCACTTTGTCGATCTTCAATTTTGACTTCTACAA
TTAGGCCGCCAACATTTTTGCCACCACTGAAGAATGTTATAATGGCCTTG
ACAATCCCTCGAGGCACCTGCGATGGCCAATCTTGCGTATTCAAAATGAC
GTTCTTAACGTAGAATTCGCCTTCGGGCACTGGGCAAAAGTCATCGTCGA
CAACGGGGAAATTTGTGGTTTCTCCAGTCTTCAGAGAGGGTTGCACAAAC
TGGACATAGAACTTTTTGAAGCACTCGCAAATGCTAGTTTGCGGCACATC
CATGACCATCCTCTTGAATTCCCCATCGCCATTGGGGCTTGAATAGAGCT
CCACGGATACCTTGAAGTCATCATTGTTCATGTCGACTGATAACT

BO04227.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:00:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG7313-PA 555 CheA75a-RA 190..552 381..19 1815 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 23:49:47
Subject Length Description Subject Range Query Range Score Percent Strand
CheA75a-RA 699 CG7313-RA 190..552 381..19 1815 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 23:49:43
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 18252337..18252699 381..19 1815 100 Minus
Blast to na_te.dros performed on 2015-02-12 23:49:45 has no hits.

BO04227.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:57:16 Download gff for BO04227.3prime
Subject Subject Range Query Range Percent Splice Strand
CG7313-PA 182..555 18..390 98   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 00:07:38 Download gff for BO04227.3prime
Subject Subject Range Query Range Percent Splice Strand
CG7313-PA 182..555 18..390 98   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-31 20:28:48 Download gff for BO04227.3prime
Subject Subject Range Query Range Percent Splice Strand
CheA75a-RA 182..552 19..390 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 02:37:01 Download gff for BO04227.3prime
Subject Subject Range Query Range Percent Splice Strand
CheA75a-RA 182..552 19..390 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 02:37:01 Download gff for BO04227.3prime
Subject Subject Range Query Range Percent Splice Strand
3L 18252329..18252699 19..390 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-31 20:28:48 Download gff for BO04227.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 18245429..18245799 19..390 99   Minus

BO04227.5prime Sequence

395 bp (394 high quality bases) assembled on 2005-12-01

> BO04227.5prime
GAAGTTATCAGTCGACATGAACAATGATGACTTCAAGGTATCCGTGGAGC
TCTATTCAAGCCCCAATGGCGATGGGGAATTCAAGAGGATGGTCATGGAT
GTGCCGCAAACTAGCATTTGCGAGTGCTTCAAAAAGTTCTATGTCCAGTT
TGTGCAACCCTCTCTGAAGACTGGAGAAACCACAAATTTCCCCGTTGTCG
ACGATGACTTTTGCCCAGTGCCCGAAGGCGAATTCTACGTTAAGAACGTC
ATTTTGAATACGCAAGATTGGCCATCGCAGGTGCCTCGAGGGATTGTCAA
GGCCATTATAACATTCTTCAGTGGTGGCAAAAATGTTGGCGGCCTAATTG
TAGAAGTCAAAATTGAAGATCGACAAAGTGCAAGCTTTCTAGACC

BO04227.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:00:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG7313-PA 555 CheA75a-RA 190..552 17..379 1815 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 23:50:16
Subject Length Description Subject Range Query Range Score Percent Strand
CheA75a-RA 699 CG7313-RA 190..552 17..379 1815 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 23:50:11
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 18252337..18252699 17..379 1815 100 Plus
Blast to na_te.dros performed on 2015-02-12 23:50:14 has no hits.

BO04227.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:57:16 Download gff for BO04227.5prime
Subject Subject Range Query Range Percent Splice Strand
CG7313-PA 182..555 8..380 98   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 00:07:39 Download gff for BO04227.5prime
Subject Subject Range Query Range Percent Splice Strand
CG7313-PA 182..555 8..380 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-31 20:28:51 Download gff for BO04227.5prime
Subject Subject Range Query Range Percent Splice Strand
CheA75a-RA 182..552 8..379 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 02:37:08 Download gff for BO04227.5prime
Subject Subject Range Query Range Percent Splice Strand
CheA75a-RA 182..552 8..379 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 02:37:08 Download gff for BO04227.5prime
Subject Subject Range Query Range Percent Splice Strand
3L 18252329..18252699 8..379 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-31 20:28:51 Download gff for BO04227.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 18245429..18245799 8..379 99   Plus

BO04227.complete Sequence

397 bp (397 high quality bases) assembled on 2005-09-08

GenBank Submission: FJ629679

> BO04227.complete
GAAGTTATCAGTCGACATGAACAATGATGACTTCAAGGTATCCGTGGAGC
TCTATTCAAGCCCCAATGGCGATGGGGAATTCAAGAGGATGGTCATGGAT
GTGCCGCAAACTAGCATTTGCGAGTGCTTCAAAAAGTTCTATGTCCAGTT
TGTGCAACCCTCTCTGAAGACTGGAGAAACCACAAATTTCCCCGTTGTCG
ACGATGACTTTTGCCCAGTGCCCGAAGGCGAATTCTACGTTAAGAACGTC
ATTTTGAATACGCAAGATTGGCCATCGCAGGTGCCTCGAGGGATTGTCAA
GGCCATTATAACATTCTTCAGTGGTGGCAAAAATGTTGGCGGCCTAATTG
TAGAAGTCAAAATTGAAGATCGACAAAGTGCAAGCTTTCTAGACCAT

BO04227.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:41:49
Subject Length Description Subject Range Query Range Score Percent Strand
CheA75a-RA 555 CG7313-PA 190..552 17..379 1815 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:41:50
Subject Length Description Subject Range Query Range Score Percent Strand
CheA75a-RA 699 CG7313-RA 190..552 17..379 1815 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:41:46
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 18252337..18252699 17..379 1815 100 Plus
Blast to na_te.dros performed on 2014-11-26 15:41:47 has no hits.

BO04227.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:42:00 Download gff for BO04227.complete
Subject Subject Range Query Range Percent Splice Strand
CheA75a-RA 182..555 8..380 98   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:11:49 Download gff for BO04227.complete
Subject Subject Range Query Range Percent Splice Strand
CheA75a-RA 182..552 8..379 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:42:10 Download gff for BO04227.complete
Subject Subject Range Query Range Percent Splice Strand
CheA75a-RA 190..552 17..381 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:42:00 Download gff for BO04227.complete
Subject Subject Range Query Range Percent Splice Strand
CheA75a-RA 182..552 8..379 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:01:44 Download gff for BO04227.complete
Subject Subject Range Query Range Percent Splice Strand
CheA75a-RA 190..552 17..381 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:01:44 Download gff for BO04227.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18252337..18252699 17..381 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:42:10 Download gff for BO04227.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 18245437..18245799 17..381 99   Plus

BO04227.pep Sequence

Translation from 16 to 397

> BO04227.pep
MNNDDFKVSVELYSSPNGDGEFKRMVMDVPQTSICECFKKFYVQFVQPSL
KTGETTNFPVVDDDFCPVPEGEFYVKNVILNTQDWPSQVPRGIVKAIITF
FSGGKNVGGLIVEVKIEDRQSASFLDH

BO04227.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 18:49:36
Subject Length Description Subject Range Query Range Score Percent Strand
CheA75a-PA 184 CG7313-PA 64..184 1..121 644 100 Plus
CheA84a-PA 180 CG33779-PA 63..178 1..118 212 34.7 Plus
CheA86a-PA 189 CG33698-PA 64..180 1..119 205 33.6 Plus
CheA56a-PA 180 CG33724-PA 67..177 3..118 152 26.7 Plus