Clone BO04248 Report

Search the DGRC for BO04248

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:42
Well:48
Vector:pDNR-Dual
Associated Gene/Transcripte(r)-RA
Protein status:BO04248.pep: validated full length
Sequenced Size:346

Clone Sequence Records

BO04248.3prime Sequence

344 bp (343 high quality bases) assembled on 2005-12-01

> BO04248.3prime
ATGGTCTAGAAAGCTTGCGGTATTGGAACTAAATGCCGCCTGACGGAGCA
GCACATAGATCTTCTCCTTGATCCAATCCTTATTGTAGGGCGCATAGGTA
TTGGTGCTCTTCTGGTAAACCATGCAGCTAATGTCCACCATTGTGTCGAT
GAAATCGAATAGCTGGCTAATGTCATACGTAATGGTCGGAGTGTTTGGAT
TGCGGCGCTTCAGGTGCTCCTCGTAGATCTTGCACACGCCCTCCATGCAC
TCGTTGACGCTCTCGTAGTCACAGTAAGTGCGGGTCTCCGGACGAGCACC
CGGCTGTACCAATAGGATGGTGTGCGACATGTCGACTGATAACT

BO04248.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:01:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG1871-PA 315 e(r)-RA 1..312 330..19 1560 100 Minus
CG1871-PB 315 e(r)-RB 1..312 330..19 1560 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-09 18:32:41
Subject Length Description Subject Range Query Range Score Percent Strand
e(r)-RE 1332 CG1871-RE 312..624 331..19 1565 100 Minus
e(r)-RD 1191 CG1871-RD 171..483 331..19 1565 100 Minus
e(r)-RC 1199 CG1871-RC 179..491 331..19 1565 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-09 18:32:35
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 8905067..8905379 19..331 1565 100 Plus
Blast to na_te.dros performed on 2015-02-09 18:32:38 has no hits.

BO04248.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:57:49 Download gff for BO04248.3prime
Subject Subject Range Query Range Percent Splice Strand
e(r)-PA 1..315 15..330 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 00:08:29 Download gff for BO04248.3prime
Subject Subject Range Query Range Percent Splice Strand
CG1871-PB 1..315 15..330 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-13 03:58:08 Download gff for BO04248.3prime
Subject Subject Range Query Range Percent Splice Strand
e(r)-RC 173..496 14..341 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-09 21:12:21 Download gff for BO04248.3prime
Subject Subject Range Query Range Percent Splice Strand
e(r)-RC 173..496 14..341 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-09 21:12:21 Download gff for BO04248.3prime
Subject Subject Range Query Range Percent Splice Strand
X 8905062..8905387 14..338 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-13 03:58:08 Download gff for BO04248.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 8799095..8799420 14..338 98   Plus

BO04248.5prime Sequence

344 bp (343 high quality bases) assembled on 2005-12-01

> BO04248.5prime
GAAGTTATCAGTCGACATGTCGCACACCATCCTATTGGTACAGCCGGGTG
CTCGTCCGGAGACCCGCACTTACTGTGACTACGAGAGCGTCAACGAGTGC
ATGGAGGGCGTGTGCAAGATCTACGAGGAGCACCTGAAGCGCCGCAATCC
AAACACTCCGACCATTACGTATGACATTAGCCAGCTATTCGATTTCATCG
ACACAATGGTGGACATTAGCTGCATGGTTTACCAGAAGAGCACCAATACC
TATGCGCCCTACAATAAGGATTGGATCAAGGAGAAGATCTATGTGCTGCT
CCGTCAGGCGGCATTTAGTTCCAATACCGCAAGCTTTCTAGACC

BO04248.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:01:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG1871-PA 315 e(r)-RA 1..312 17..328 1560 100 Plus
CG1871-PB 315 e(r)-RB 1..312 17..328 1560 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 04:41:53
Subject Length Description Subject Range Query Range Score Percent Strand
e(r)-RE 1332 CG1871-RE 312..624 16..328 1565 100 Plus
e(r)-RD 1191 CG1871-RD 171..483 16..328 1565 100 Plus
e(r)-RC 1199 CG1871-RC 179..491 16..328 1565 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 04:41:46
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 8905067..8905379 328..16 1565 100 Minus
Blast to na_te.dros performed on 2015-02-11 04:41:50 has no hits.

BO04248.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:57:50 Download gff for BO04248.5prime
Subject Subject Range Query Range Percent Splice Strand
e(r)-PA 1..315 17..332 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 00:08:30 Download gff for BO04248.5prime
Subject Subject Range Query Range Percent Splice Strand
CG1871-PB 1..315 17..332 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-23 06:12:12 Download gff for BO04248.5prime
Subject Subject Range Query Range Percent Splice Strand
e(r)-RC 173..496 6..333 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 09:17:50 Download gff for BO04248.5prime
Subject Subject Range Query Range Percent Splice Strand
e(r)-RC 173..496 6..333 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 09:17:50 Download gff for BO04248.5prime
Subject Subject Range Query Range Percent Splice Strand
X 8905062..8905387 9..333 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-23 06:12:12 Download gff for BO04248.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 8799095..8799420 9..333 98   Minus

BO04248.complete Sequence

346 bp (346 high quality bases) assembled on 2005-09-08

GenBank Submission: FJ629691

> BO04248.complete
GAAGTTATCAGTCGACATGTCGCACACCATCCTATTGGTACAGCCGGGTG
CTCGTCCGGAGACCCGCACTTACTGTGACTACGAGAGCGTCAACGAGTGC
ATGGAGGGCGTGTGCAAGATCTACGAGGAGCACCTGAAGCGCCGCAATCC
AAACACTCCGACCATTACGTATGACATTAGCCAGCTATTCGATTTCATCG
ACACAATGGTGGACATTAGCTGCATGGTTTACCAGAAGAGCACCAATACC
TATGCGCCCTACAATAAGGATTGGATCAAGGAGAAGATCTATGTGCTGCT
CCGTCAGGCGGCATTTAGTTCCAATACCGCAAGCTTTCTAGACCAT

BO04248.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 14:07:40
Subject Length Description Subject Range Query Range Score Percent Strand
e(r)-RE 315 CG1871-PE 1..312 17..328 1560 100 Plus
e(r)-RD 315 CG1871-PD 1..312 17..328 1560 100 Plus
e(r)-RC 315 CG1871-PC 1..312 17..328 1560 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:07:41
Subject Length Description Subject Range Query Range Score Percent Strand
e(r)-RE 1332 CG1871-RE 312..624 16..328 1565 100 Plus
e(r)-RD 1191 CG1871-RD 171..483 16..328 1565 100 Plus
e(r)-RC 1199 CG1871-RC 179..491 16..328 1565 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 14:07:38
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 8905067..8905379 328..16 1565 100 Minus
Blast to na_te.dros performed on 2014-11-27 14:07:39 has no hits.

BO04248.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:05:32 Download gff for BO04248.complete
Subject Subject Range Query Range Percent Splice Strand
e(r)-RB 1..315 17..332 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 05:20:30 Download gff for BO04248.complete
Subject Subject Range Query Range Percent Splice Strand
e(r)-RA 220..543 6..333 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:34:22 Download gff for BO04248.complete
Subject Subject Range Query Range Percent Splice Strand
e(r)-RC 180..491 17..330 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:05:32 Download gff for BO04248.complete
Subject Subject Range Query Range Percent Splice Strand
e(r)-RA 220..543 6..333 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:03:56 Download gff for BO04248.complete
Subject Subject Range Query Range Percent Splice Strand
e(r)-RC 180..491 17..330 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 15:03:56 Download gff for BO04248.complete
Subject Subject Range Query Range Percent Splice Strand
X 8905065..8905378 17..330 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:34:22 Download gff for BO04248.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 8799098..8799411 17..330 99   Minus

BO04248.pep Sequence

Translation from 16 to 346

> BO04248.pep
MSHTILLVQPGARPETRTYCDYESVNECMEGVCKIYEEHLKRRNPNTPTI
TYDISQLFDFIDTMVDISCMVYQKSTNTYAPYNKDWIKEKIYVLLRQAAF
SSNTASFLDH

BO04248.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 20:47:15
Subject Length Description Subject Range Query Range Score Percent Strand
e(r)-PE 104 CG1871-PE 1..104 1..104 560 100 Plus
e(r)-PD 104 CG1871-PD 1..104 1..104 560 100 Plus
e(r)-PC 104 CG1871-PC 1..104 1..104 560 100 Plus
e(r)-PB 104 CG1871-PB 1..104 1..104 560 100 Plus
e(r)-PA 104 CG1871-PA 1..104 1..104 560 100 Plus