Clone BO04330 Report

Search the DGRC for BO04330

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:43
Well:30
Vector:pDNR-Dual
Associated Gene/TranscriptPbprp2-RA
Protein status:BO04330.pep: validated full length
Sequenced Size:484

Clone Sequence Records

BO04330.3prime Sequence

482 bp (481 high quality bases) assembled on 2005-12-01

> BO04330.3prime
ATGGTCTAGAAAGCTTGCGTGCTCCTCCAGCTCGAGTCCATGCTCCTTCA
TTTGCTCGTAAATGCATTCCTCGTAGGCGAAGGCAGCGTCGCAATGATCC
TCGGGTGTCTCGATGGCCTCGCACTTGGCCACCACCTCGGCGGGAGCGTC
TTCCTTCTCTGCATCGTGCTTGCTCATGACCTTGACCAACTCGATGGCGT
GTTCCTTGTTCAGCTTACCGGATTCATCCATTATCTGCAGCTTTTTCATC
ACGCAGGCGCGCAGGCACTTGGCCTCGTGTCTCTCGGGCAGGTCGTGGCT
CATCAGCTGCTCCACATCCTCATCGGTGGCTCCCGTCTCAGCCTTGCACT
CGTTGGCCAGCTCGGCGGCGTGGTCCCTGTTGATCTCCTCGTGCGGCTTG
GCGCTGGTGGCGCCCAGGCAGAGGATGCCCACTAGGAGCAGGACGGTCAG
GTGAACCAGATGCGACATGTCGACTGATAACT

BO04330.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:02:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG1668-PA 453 Pbprp2-RA 1..450 468..19 2250 100 Minus
CG1668-PB 453 Pbprp2-RB 1..450 468..19 2250 100 Minus
CG6641-PA 432 Pbprp5-RA 189..215 271..245 135 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 06:20:07
Subject Length Description Subject Range Query Range Score Percent Strand
Obp19d-RB 624 CG1668-RB 44..498 473..19 2260 99.8 Minus
Obp19d-RA 1101 CG1668-RA 521..975 473..19 2260 99.8 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 06:19:59
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 20420133..20420285 473..321 750 99.3 Minus
X 23542271 X 20420577..20420713 231..95 685 100 Minus
X 23542271 X 20420415..20420504 321..232 450 100 Minus
X 23542271 X 20420778..20420853 94..19 380 100 Minus
Blast to na_te.dros performed on 2015-02-12 06:20:03 has no hits.

BO04330.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 02:00:08 Download gff for BO04330.3prime
Subject Subject Range Query Range Percent Splice Strand
CG1668-PB 1..453 16..468 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 00:11:54 Download gff for BO04330.3prime
Subject Subject Range Query Range Percent Splice Strand
CG1668-PB 1..453 16..468 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 05:26:09 Download gff for BO04330.3prime
Subject Subject Range Query Range Percent Splice Strand
Obp19d-RA 521..975 19..473 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 08:01:06 Download gff for BO04330.3prime
Subject Subject Range Query Range Percent Splice Strand
Obp19d-RA 521..975 19..473 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 08:01:06 Download gff for BO04330.3prime
Subject Subject Range Query Range Percent Splice Strand
X 20420133..20420285 321..473 99 -> Minus
X 20420416..20420504 232..320 100 -> Minus
X 20420577..20420713 95..231 100 -> Minus
X 20420778..20420853 19..94 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 05:26:09 Download gff for BO04330.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 20291805..20291880 19..94 100   Minus
arm_X 20291443..20291531 232..320 100 -> Minus
arm_X 20291160..20291312 321..473 99 -> Minus
arm_X 20291604..20291740 95..231 100 -> Minus

BO04330.5prime Sequence

482 bp (481 high quality bases) assembled on 2005-12-01

> BO04330.5prime
GAAGTTATCAGTCGACATGTCGCATCTGGTTCACCTGACCGTCCTGCTCC
TAGTGGGCATCCTCTGCCTGGGCGCCACCAGCGCCAAGCCGCACGAGGAG
ATCAACAGGGACCACGCCGCCGAGCTGGCCAACGAGTGCAAGGCTGAGAC
GGGAGCCACCGATGAGGATGTGGAGCAGCTGATGAGCCACGACCTGCCCG
AGAGACACGAGGCCAAGTGCCTGCGCGCCTGCGTGATGAAAAAGCTGCAG
ATAATGGATGAATCCGGTAAGCTGAACAAGGAACACGCCATCGAGTTGGT
CAAGGTCATGAGCAAGCACGATGCAGAGAAGGAAGACGCTCCCGCCGAGG
TGGTGGCCAAGTGCGAGGCCATCGAGACACCCGAGGATCATTGCGACGCT
GCCTTCGCCTACGAGGAATGCATTTACGAGCAAATGAAGGAGCATGGACT
CGAGCTGGAGGAGCACGCAAGCTTTCTAGACC

BO04330.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:02:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG1668-PA 453 Pbprp2-RA 1..450 17..466 2250 100 Plus
CG1668-PB 453 Pbprp2-RB 1..450 17..466 2250 100 Plus
CG6641-PA 432 Pbprp5-RA 189..215 214..240 135 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 16:17:30
Subject Length Description Subject Range Query Range Score Percent Strand
Obp19d-RB 624 CG1668-RB 44..498 12..466 2260 99.8 Plus
Obp19d-RA 1101 CG1668-RA 521..975 12..466 2260 99.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 16:17:22
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 20420133..20420285 12..164 750 99.3 Plus
X 23542271 X 20420577..20420713 254..390 685 100 Plus
X 23542271 X 20420415..20420504 164..253 450 100 Plus
X 23542271 X 20420778..20420853 391..466 380 100 Plus
Blast to na_te.dros performed on 2015-02-10 16:17:26 has no hits.

BO04330.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 02:00:09 Download gff for BO04330.5prime
Subject Subject Range Query Range Percent Splice Strand
CG1668-PB 1..453 17..469 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 00:11:56 Download gff for BO04330.5prime
Subject Subject Range Query Range Percent Splice Strand
CG1668-PB 1..453 17..469 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-15 02:40:53 Download gff for BO04330.5prime
Subject Subject Range Query Range Percent Splice Strand
Obp19d-RA 521..975 12..466 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:21:02 Download gff for BO04330.5prime
Subject Subject Range Query Range Percent Splice Strand
Obp19d-RA 521..975 12..466 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:21:02 Download gff for BO04330.5prime
Subject Subject Range Query Range Percent Splice Strand
X 20420133..20420285 12..164 99 -> Plus
X 20420416..20420504 165..253 100 -> Plus
X 20420577..20420713 254..390 100 -> Plus
X 20420778..20420853 391..466 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-15 02:40:53 Download gff for BO04330.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 20291160..20291312 12..164 99 -> Plus
arm_X 20291443..20291531 165..253 100 -> Plus
arm_X 20291604..20291740 254..390 100 -> Plus
arm_X 20291805..20291880 391..466 100   Plus

BO04330.complete Sequence

484 bp (484 high quality bases) assembled on 2005-09-08

GenBank Submission: FJ629728

> BO04330.complete
GAAGTTATCAGTCGACATGTCGCATCTGGTTCACCTGACCGTCCTGCTCC
TAGTGGGCATCCTCTGCCTGGGCGCCACCAGCGCCAAGCCGCACGAGGAG
ATCAACAGGGACCACGCCGCCGAGCTGGCCAACGAGTGCAAGGCTGAGAC
GGGAGCCACCGATGAGGATGTGGAGCAGCTGATGAGCCACGACCTGCCCG
AGAGACACGAGGCCAAGTGCCTGCGCGCCTGCGTGATGAAAAAGCTGCAG
ATAATGGATGAATCCGGTAAGCTGAACAAGGAACACGCCATCGAGTTGGT
CAAGGTCATGAGCAAGCACGATGCAGAGAAGGAAGACGCTCCCGCCGAGG
TGGTGGCCAAGTGCGAGGCCATCGAGACACCCGAGGATCATTGCGACGCT
GCCTTCGCCTACGAGGAATGCATTTACGAGCAAATGAAGGAGCATGGACT
CGAGCTGGAGGAGCACGCAAGCTTTCTAGACCAT

BO04330.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 00:27:50
Subject Length Description Subject Range Query Range Score Percent Strand
Obp19d-RB 453 CG1668-PB 1..450 17..466 2250 100 Plus
Obp19d-RA 453 CG1668-PA 1..450 17..466 2250 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 00:27:52
Subject Length Description Subject Range Query Range Score Percent Strand
Obp19d-RB 624 CG1668-RB 44..498 12..466 2260 99.8 Plus
Obp19d-RA 1101 CG1668-RA 521..975 12..466 2260 99.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 00:27:48
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 20420133..20420285 12..164 750 99.3 Plus
X 23542271 X 20420577..20420713 254..390 685 100 Plus
X 23542271 X 20420415..20420504 164..253 450 100 Plus
X 23542271 X 20420778..20420853 391..466 380 100 Plus
Blast to na_te.dros performed on 2014-11-28 00:27:49 has no hits.

BO04330.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:36:59 Download gff for BO04330.complete
Subject Subject Range Query Range Percent Splice Strand
Pbprp2-RB 1..453 17..469 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:05:07 Download gff for BO04330.complete
Subject Subject Range Query Range Percent Splice Strand
Pbprp2-RA 521..975 12..466 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:52:39 Download gff for BO04330.complete
Subject Subject Range Query Range Percent Splice Strand
Obp19d-RA 526..975 17..468 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:36:59 Download gff for BO04330.complete
Subject Subject Range Query Range Percent Splice Strand
Pbprp2-RA 521..975 12..466 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:20:53 Download gff for BO04330.complete
Subject Subject Range Query Range Percent Splice Strand
Obp19d-RA 526..975 17..468 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:20:53 Download gff for BO04330.complete
Subject Subject Range Query Range Percent Splice Strand
X 20420138..20420285 17..164 100 -> Plus
X 20420416..20420504 165..253 100 -> Plus
X 20420577..20420713 254..390 100 -> Plus
X 20420778..20420853 391..468 97   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:52:39 Download gff for BO04330.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 20291165..20291312 17..164 100 -> Plus
arm_X 20291443..20291531 165..253 100 -> Plus
arm_X 20291604..20291740 254..390 100 -> Plus
arm_X 20291805..20291880 391..468 97   Plus

BO04330.pep Sequence

Translation from 16 to 484

> BO04330.pep
MSHLVHLTVLLLVGILCLGATSAKPHEEINRDHAAELANECKAETGATDE
DVEQLMSHDLPERHEAKCLRACVMKKLQIMDESGKLNKEHAIELVKVMSK
HDAEKEDAPAEVVAKCEAIETPEDHCDAAFAYEECIYEQMKEHGLELEEH
ASFLDH

BO04330.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 18:41:07
Subject Length Description Subject Range Query Range Score Percent Strand
Obp19d-PB 150 CG1668-PB 1..150 1..150 787 100 Plus
Obp19d-PA 150 CG1668-PA 1..150 1..150 787 100 Plus
Obp28a-PA 143 CG6641-PA 4..142 8..145 244 38.3 Plus