Clone BO06040 Report

Search the DGRC for BO06040

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:60
Well:40
Vector:pDNR-Dual
Associated Gene/TranscriptHmgD-RA
Protein status:BO06040.pep: validated full length
Sequenced Size:370

Clone Sequence Records

BO06040.3prime Sequence

368 bp (367 high quality bases) assembled on 2005-12-02

> BO06040.3prime
ATGGTCTAGAAAGCTTGCCTCGCTCTCATCATCGTCGTCCTCGTCGGACT
CCTCCTTCTTGCTCTTCTTCGCCACCTTTTTCGCTGGTTTCGCGCGCTTC
TTGGCTCCACCACCGTTGGCAGCACTGCTGCCACCATTGGCCTCGAACTC
CTTGACCGCCCGATCGTAGTCGTCCTTGGCCTTAGCAGCCTTGGCCTCCC
ACTCAGACTTGTCCTTCATTGCCCTCCATAATTCACCACCGCGCTTGGCC
ACCTCGGTGACCTTGATGCCGGGATTCTCGCGCTTGATCGACTCGCGGGC
ACTGTTGAGCCACAGCATGTAGGCGGAGAGTGGGCGTTTTGGCTTATCAG
ACATGTCGACTGATAACT

BO06040.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:33:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG17950-PA 339 HmgD-RA 1..336 354..19 1680 100 Minus
CG17950-PB 339 HmgD-RB 1..336 354..19 1680 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 00:44:30
Subject Length Description Subject Range Query Range Score Percent Strand
HmgD-RD 1495 CG17950-RD 670..1005 354..19 1680 100 Minus
HmgD-RC 967 CG17950-RC 142..477 354..19 1680 100 Minus
HmgD-RB 1279 CG17950-RB 94..429 354..19 1680 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 00:44:25
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 21715692..21715877 204..19 930 100 Minus
2R 25286936 2R 21715468..21715618 354..204 755 100 Minus
2R 25286936 2R 21698391..21698510 208..327 195 77.5 Plus
Blast to na_te.dros performed on 2015-02-13 00:44:28 has no hits.

BO06040.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 02:38:10 Download gff for BO06040.3prime
Subject Subject Range Query Range Percent Splice Strand
HmgD-PB 1..339 18..354 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 01:06:21 Download gff for BO06040.3prime
Subject Subject Range Query Range Percent Splice Strand
CG17950-PB 1..339 18..354 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-31 20:14:06 Download gff for BO06040.3prime
Subject Subject Range Query Range Percent Splice Strand
HmgD-RA 86..430 19..362 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 02:52:21 Download gff for BO06040.3prime
Subject Subject Range Query Range Percent Splice Strand
HmgD-RB 85..429 19..362 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 02:52:21 Download gff for BO06040.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 21715459..21715617 205..362 97 -> Minus
2R 21715692..21715877 19..204 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-31 20:14:06 Download gff for BO06040.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 17602964..17603122 205..362 97 -> Minus
arm_2R 17603197..17603382 19..204 100   Minus

BO06040.5prime Sequence

368 bp (367 high quality bases) assembled on 2005-12-02

> BO06040.5prime
GAAGTTATCAGTCGACATGTCTGATAAGCCAAAACGCCCACTCTCCGCCT
ACATGCTGTGGCTCAACAGTGCCCGCGAGTCGATCAAGCGCGAGAATCCC
GGCATCAAGGTCACCGAGGTGGCCAAGCGCGGTGGTGAATTATGGAGGGC
AATGAAGGACAAGTCTGAGTGGGAGGCCAAGGCTGCTAAGGCCAAGGACG
ACTACGATCGGGCGGTCAAGGAGTTCGAGGCCAATGGTGGCAGCAGTGCT
GCCAACGGTGGTGGAGCCAAGAAGCGCGCGAAACCAGCGAAAAAGGTGGC
GAAGAAGAGCAAGAAGGAGGAGTCCGACGAGGACGACGATGATGAGAGCG
AGGCAAGCTTTCTAGACC

BO06040.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:33:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG17950-PA 339 HmgD-RA 1..336 17..352 1680 100 Plus
CG17950-PB 339 HmgD-RB 1..336 17..352 1680 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 02:51:34
Subject Length Description Subject Range Query Range Score Percent Strand
HmgD-RD 1495 CG17950-RD 670..1005 17..352 1680 100 Plus
HmgD-RC 967 CG17950-RC 142..477 17..352 1680 100 Plus
HmgD-RB 1279 CG17950-RB 94..429 17..352 1680 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 02:51:29
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 21715692..21715877 167..352 930 100 Plus
2R 25286936 2R 21715468..21715618 17..167 755 100 Plus
2R 25286936 2R 21698391..21698510 163..44 195 77.5 Minus
Blast to na_te.dros performed on 2015-02-11 02:51:32 has no hits.

BO06040.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 02:38:10 Download gff for BO06040.5prime
Subject Subject Range Query Range Percent Splice Strand
HmgD-PB 1..339 17..353 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 01:06:22 Download gff for BO06040.5prime
Subject Subject Range Query Range Percent Splice Strand
CG17950-PB 1..339 17..353 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-22 20:51:32 Download gff for BO06040.5prime
Subject Subject Range Query Range Percent Splice Strand
HmgD-RA 86..430 9..352 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 06:01:47 Download gff for BO06040.5prime
Subject Subject Range Query Range Percent Splice Strand
HmgD-RB 85..429 9..352 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 06:01:47 Download gff for BO06040.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 21715459..21715617 9..166 97 -> Plus
2R 21715692..21715877 167..352 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-22 20:51:32 Download gff for BO06040.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 17602964..17603122 9..166 97 -> Plus
arm_2R 17603197..17603382 167..352 100   Plus

BO06040.complete Sequence

370 bp (370 high quality bases) assembled on 2005-10-20

GenBank Submission: FJ630246

> BO06040.complete
GAAGTTATCAGTCGACATGTCTGATAAGCCAAAACGCCCACTCTCCGCCT
ACATGCTGTGGCTCAACAGTGCCCGCGAGTCGATCAAGCGCGAGAATCCC
GGCATCAAGGTCACCGAGGTGGCCAAGCGCGGTGGTGAATTATGGAGGGC
AATGAAGGACAAGTCTGAGTGGGAGGCCAAGGCTGCTAAGGCCAAGGACG
ACTACGATCGGGCGGTCAAGGAGTTCGAGGCCAATGGTGGCAGCAGTGCT
GCCAACGGTGGTGGAGCCAAGAAGCGCGCGAAACCAGCGAAAAAGGTGGC
GAAGAAGAGCAAGAAGGAGGAGTCCGACGAGGACGACGATGATGAGAGCG
AGGCAAGCTTTCTAGACCAT

BO06040.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 00:05:13
Subject Length Description Subject Range Query Range Score Percent Strand
HmgD-RD 339 CG17950-PD 1..336 17..352 1680 100 Plus
HmgD-RC 339 CG17950-PC 1..336 17..352 1680 100 Plus
HmgD-RB 339 CG17950-PB 1..336 17..352 1680 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 00:05:15
Subject Length Description Subject Range Query Range Score Percent Strand
HmgD-RD 1495 CG17950-RD 670..1005 17..352 1680 100 Plus
HmgD-RC 967 CG17950-RC 142..477 17..352 1680 100 Plus
HmgD-RB 1279 CG17950-RB 94..429 17..352 1680 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 00:05:10
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 21715692..21715877 167..352 930 100 Plus
2R 25286936 2R 21715468..21715618 17..167 755 100 Plus
2R 25286936 2R 21698391..21698510 163..44 195 77.5 Minus
Blast to na_te.dros performed on 2014-11-28 00:05:11 has no hits.

BO06040.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:56:28 Download gff for BO06040.complete
Subject Subject Range Query Range Percent Splice Strand
HmgD-RB 1..339 17..353 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:28:59 Download gff for BO06040.complete
Subject Subject Range Query Range Percent Splice Strand
HmgD-RB 318..662 9..352 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 20:17:26 Download gff for BO06040.complete
Subject Subject Range Query Range Percent Splice Strand
HmgD-RA 95..430 17..354 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:56:28 Download gff for BO06040.complete
Subject Subject Range Query Range Percent Splice Strand
HmgD-RB 318..662 9..352 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:26:02 Download gff for BO06040.complete
Subject Subject Range Query Range Percent Splice Strand
HmgD-RB 94..429 17..354 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:26:02 Download gff for BO06040.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21715468..21715617 17..166 100 -> Plus
2R 21715692..21715877 167..354 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 20:17:26 Download gff for BO06040.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 17602973..17603122 17..166 100 -> Plus
arm_2R 17603197..17603382 167..354 98   Plus

BO06040.pep Sequence

Translation from 16 to 370

> BO06040.pep
MSDKPKRPLSAYMLWLNSARESIKRENPGIKVTEVAKRGGELWRAMKDKS
EWEAKAAKAKDDYDRAVKEFEANGGSSAANGGGAKKRAKPAKKVAKKSKK
EESDEDDDDESEASFLDH

BO06040.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 18:21:47
Subject Length Description Subject Range Query Range Score Percent Strand
HmgD-PD 112 CG17950-PD 1..112 1..112 577 100 Plus
HmgD-PC 112 CG17950-PC 1..112 1..112 577 100 Plus
HmgD-PB 112 CG17950-PB 1..112 1..112 577 100 Plus
HmgD-PA 112 CG17950-PA 1..112 1..112 577 100 Plus
HmgZ-PD 111 CG17921-PD 4..111 3..112 382 64.9 Plus