Clone BO06215 Report

Search the DGRC for BO06215

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:62
Well:15
Vector:pDNR-Dual
Associated Gene/TranscriptDms-RA
Protein status:BO06215.pep: Imported from assembly
Sequenced Size:334

Clone Sequence Records

BO06215.3prime Sequence

332 bp (331 high quality bases) assembled on 2005-12-03

> BO06215.3prime
ATGGTCTCGAAAGCCTGCACGACGTTTTCCGAAACGCAGGAAGACGTGAT
CGACATCCGTTCGCTTGTTGTAGTTCTTCAACAGGTCATCAGAGTTGGCC
ACCAAAGCGGATGCCTCGTTGTTGATGTAGGACTTCAGCGCCGACGTCAG
TTGATCGGAGTTCTCCAGGGCCTGGCACACCTTCCGGATGTGCGGCGGCA
TCTCCTCGACGATGCCAGACTGGCATAGAGGTGGACCCTGAACTGCGGCC
CGTGTGTTGGACACGGCCAGGAGGACGATGGCCAGGCAGCAGGCGACAAA
GAACTGAGCGAAGGACATGTCGACTGATAACT

BO06215.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:37:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG6440-PA 303 Dms-RA 1..300 318..19 1500 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 06:05:33
Subject Length Description Subject Range Query Range Score Percent Strand
Ms-RB 908 CG6440-RB 114..414 319..19 1505 100 Minus
Ms-RC 1065 CG6440-RC 131..431 319..19 1505 100 Minus
Ms-RA 925 CG6440-RA 131..431 319..19 1505 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 06:05:28
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 24342828..24343039 319..108 1060 100 Minus
3R 32079331 3R 24343102..24343191 108..19 450 100 Minus
Blast to na_te.dros performed on 2015-02-13 06:05:31 has no hits.

BO06215.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 02:43:17 Download gff for BO06215.3prime
Subject Subject Range Query Range Percent Splice Strand
Dms-PA 1..303 16..318 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 01:13:42 Download gff for BO06215.3prime
Subject Subject Range Query Range Percent Splice Strand
CG6440-PA 1..303 16..318 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-01 17:59:14 Download gff for BO06215.3prime
Subject Subject Range Query Range Percent Splice Strand
Ms-RA 124..441 10..327 97   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 08:03:16 Download gff for BO06215.3prime
Subject Subject Range Query Range Percent Splice Strand
Ms-RA 124..441 10..327 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 08:03:16 Download gff for BO06215.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 24342828..24343039 108..319 100 -> Minus
3R 24343103..24343201 10..107 95   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-01 17:59:14 Download gff for BO06215.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 20168550..20168761 108..319 100 -> Minus
arm_3R 20168825..20168923 10..107 95   Minus

BO06215.5prime Sequence

332 bp (331 high quality bases) assembled on 2005-12-03

> BO06215.5prime
GAAGTTATCAGTCGACATGTCCTTCGCTCAGTTCTTTGTCGCCTGCTGCC
TGGCCATCGTCCTCCTGGCCGTGTCCAACACACGGGCCGCAGTTCAGGGT
CCACCTCTATGCCAGTCTGGCATCGTCGAGGAGATGCCGCCGCACATCCG
GAAGGTGTGCCAGGCCCTGGAGAACTCCGATCAACTGACGTCGGCGCTGA
AGTCCTACATCAACAACGAGGCATCCGCTTTGGTGGCCAACTCTGATGAC
CTGTTGAAGAACTACAACAAGCGAACGGATGTCGATCACGTCTTCCTGCG
TTTCGGAAAACGTCGTGCAGGCTTTCGAGACC

BO06215.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:37:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG6440-PA 303 Dms-RA 1..300 17..316 1500 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 15:54:40
Subject Length Description Subject Range Query Range Score Percent Strand
Ms-RB 908 CG6440-RB 114..414 16..316 1505 100 Plus
Ms-RC 1065 CG6440-RC 131..431 16..316 1505 100 Plus
Ms-RA 925 CG6440-RA 131..431 16..316 1505 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 15:54:37
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 24342828..24343039 16..227 1060 100 Plus
3R 32079331 3R 24343102..24343191 227..316 450 100 Plus
Blast to na_te.dros performed on 2015-02-13 15:54:38 has no hits.

BO06215.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 02:43:18 Download gff for BO06215.5prime
Subject Subject Range Query Range Percent Splice Strand
Dms-PA 1..303 17..319 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 01:13:43 Download gff for BO06215.5prime
Subject Subject Range Query Range Percent Splice Strand
CG6440-PA 1..303 17..319 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-03 11:06:53 Download gff for BO06215.5prime
Subject Subject Range Query Range Percent Splice Strand
Ms-RA 124..441 8..325 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 17:34:51 Download gff for BO06215.5prime
Subject Subject Range Query Range Percent Splice Strand
Ms-RA 124..441 8..325 97   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 17:34:51 Download gff for BO06215.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 24342828..24343039 16..227 100 -> Plus
3R 24343103..24343201 228..325 95   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-03 11:06:53 Download gff for BO06215.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 20168825..20168923 228..325 95   Plus
arm_3R 20168550..20168761 16..227 100 -> Plus

BO06215.complete Sequence

334 bp assembled on 2011-06-28

> BO06215.complete
GAAGTTATCAGTCGACATGTCCTTCGCTCAGTTCTTTGTCGCCTGCTGCC
TGGCCATCGTCCTCCTGGCCGTGTCCAACACACGGGCCGCAGTTCAGGGT
CCACCTCTATGCCAGTCTGGCATCGTCGAGGAGATGCCGCCGCACATCCG
GAAGGTGTGCCAGGCCCTGGAGAACTCCGATCAACTGACGTCGGCGCTGA
AGTCCTACATCAACAACGAGGCATCCGCTTTGGTGGCCAACTCTGATGAC
CTGTTGAAGAACTACAACAAGCGAACGGATGTCGATCACGTCTTCCTGCG
TTTCGGAAAACGTCGTGCAGGCTTTCGAGACCAT

BO06215.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:05:12
Subject Length Description Subject Range Query Range Score Percent Strand
Ms-RB 303 CG6440-PB 1..300 17..316 1500 100 Plus
Ms-RC 303 CG6440-PC 1..300 17..316 1500 100 Plus
Ms-RA 303 CG6440-PA 1..300 17..316 1500 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:05:13
Subject Length Description Subject Range Query Range Score Percent Strand
Ms-RB 908 CG6440-RB 114..414 16..316 1505 100 Plus
Ms-RC 1065 CG6440-RC 131..431 16..316 1505 100 Plus
Ms-RA 925 CG6440-RA 131..431 16..316 1505 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:05:09
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 24342828..24343039 16..227 1060 100 Plus
3R 32079331 3R 24343102..24343191 227..316 450 100 Plus
Blast to na_te.dros performed on 2014-11-26 16:05:11 has no hits.

BO06215.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-06-28 12:16:04 Download gff for BO06215.complete
Subject Subject Range Query Range Percent Splice Strand
Dms-RA 130..429 17..318 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:51:58 Download gff for BO06215.complete
Subject Subject Range Query Range Percent Splice Strand
Ms-RA 132..431 17..318 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:10:54 Download gff for BO06215.complete
Subject Subject Range Query Range Percent Splice Strand
Ms-RA 132..431 17..318 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:10:54 Download gff for BO06215.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24342829..24343039 17..227 100 -> Plus
3R 24343103..24343191 228..318 97   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:51:58 Download gff for BO06215.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 20168551..20168761 17..227 100 -> Plus
arm_3R 20168825..20168913 228..318 97   Plus

BO06215.pep Sequence

Translation from 16 to 334

> BO06215.pep
MSFAQFFVACCLAIVLLAVSNTRAAVQGPPLCQSGIVEEMPPHIRKVCQA
LENSDQLTSALKSYINNEASALVANSDDLLKNYNKRTDVDHVFLRFGKRR
AGFRDH

BO06215.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:49:17
Subject Length Description Subject Range Query Range Score Percent Strand
Ms-PB 100 CG6440-PB 1..100 1..100 511 100 Plus
Ms-PC 100 CG6440-PC 1..100 1..100 511 100 Plus
Ms-PA 100 CG6440-PA 1..100 1..100 511 100 Plus