Clone BO06315 Report

Search the DGRC for BO06315

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:63
Well:15
Vector:pDNR-Dual
Associated Gene/TranscriptDms-RA
Protein status:BO06315.pep: validated full length
Sequenced Size:334

Clone Sequence Records

BO06315.5prime Sequence

332 bp (331 high quality bases) assembled on 2005-12-03

> BO06315.5prime
GAAGTTATCAGTCGACATGTCCTTCGCTCAGTTCTTTGTCGCCTGCTGCC
TGGCCATCGTCCTCCTGGCCGTGTCCAACACACGGGCCGCAGTTCAGGGT
CCACCTCTATGCCAGTCTGGCATCGTCGAGGAGATGCCGCCGCACATCCG
GAAGGTGTGCCAGGCCCTGGAGAACTCCGATCAACTGACGTCGGCGCTGA
AGTCCTACATCAACAACGAGGCATCCGCTTTGGTGGCCAACTCTGATGAC
CTGTTGAAGAACTACAACAAGCGAACGGATGTCGATCACGTCTTCCTGCG
TTTCGGAAAACGTCGTGCAAGCTTTCTAGACC

BO06315.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:39:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG6440-PA 303 Dms-RA 1..300 17..316 1500 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 06:07:40
Subject Length Description Subject Range Query Range Score Percent Strand
Ms-RB 908 CG6440-RB 114..414 16..316 1505 100 Plus
Ms-RC 1065 CG6440-RC 131..431 16..316 1505 100 Plus
Ms-RA 925 CG6440-RA 131..431 16..316 1505 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 06:07:39
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 24342828..24343039 16..227 1060 100 Plus
3R 32079331 3R 24343102..24343191 227..316 450 100 Plus
Blast to na_te.dros performed on 2015-02-13 06:07:40 has no hits.

BO06315.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 02:46:07 Download gff for BO06315.5prime
Subject Subject Range Query Range Percent Splice Strand
Dms-PA 1..303 17..320 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 01:17:31 Download gff for BO06315.5prime
Subject Subject Range Query Range Percent Splice Strand
CG6440-PA 1..303 17..320 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-01 17:59:34 Download gff for BO06315.5prime
Subject Subject Range Query Range Percent Splice Strand
Ms-RA 124..435 8..321 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 08:06:45 Download gff for BO06315.5prime
Subject Subject Range Query Range Percent Splice Strand
Ms-RA 124..435 8..321 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 08:06:45 Download gff for BO06315.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 24342828..24343039 16..227 100 -> Plus
3R 24343103..24343195 228..321 97   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-01 17:59:34 Download gff for BO06315.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 20168550..20168761 16..227 100 -> Plus
arm_3R 20168825..20168917 228..321 97   Plus

BO06315.3prime Sequence

332 bp (331 high quality bases) assembled on 2005-12-03

> BO06315.3prime
ATGGTCTAGAAAGCTTGCACGACGTTTTCCGAAACGCAGGAAGACGTGAT
CGACATCCGTTCGCTTGTTGTAGTTCTTCAACAGGTCATCAGAGTTGGCC
ACCAAAGCGGATGCCTCGTTGTTGATGTAGGACTTCAGCGCCGACGTCAG
TTGATCGGAGTTCTCCAGGGCCTGGCACACCTTCCGGATGTGCGGCGGCA
TCTCCTCGACGATGCCAGACTGGCATAGAGGTGGACCCTGAACTGCGGCC
CGTGTGTTGGACACGGCCAGGAGGACGATGGCCAGGCAGCAGGCGACAAA
GAACTGAGCGAAGGACATGTCGACTGATAACT

BO06315.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:39:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG6440-PA 303 Dms-RA 1..300 318..19 1500 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 06:55:36
Subject Length Description Subject Range Query Range Score Percent Strand
Ms-RB 908 CG6440-RB 114..414 319..19 1505 100 Minus
Ms-RC 1065 CG6440-RC 131..431 319..19 1505 100 Minus
Ms-RA 925 CG6440-RA 131..431 319..19 1505 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 06:55:30
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 24342828..24343039 319..108 1060 100 Minus
3R 32079331 3R 24343102..24343191 108..19 450 100 Minus
Blast to na_te.dros performed on 2015-02-12 06:55:33 has no hits.

BO06315.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 02:46:06 Download gff for BO06315.3prime
Subject Subject Range Query Range Percent Splice Strand
Dms-PA 1..303 15..318 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 01:17:29 Download gff for BO06315.3prime
Subject Subject Range Query Range Percent Splice Strand
CG6440-PA 1..303 15..318 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 05:31:57 Download gff for BO06315.3prime
Subject Subject Range Query Range Percent Splice Strand
Ms-RA 124..435 14..327 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 08:32:25 Download gff for BO06315.3prime
Subject Subject Range Query Range Percent Splice Strand
Ms-RA 124..435 14..327 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 08:32:25 Download gff for BO06315.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 24343103..24343195 14..107 97   Minus
3R 24342828..24343039 108..319 100 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 05:31:57 Download gff for BO06315.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 20168550..20168761 108..319 100 -> Minus
arm_3R 20168825..20168917 14..107 97   Minus

BO06315.complete Sequence

334 bp assembled on 2007-10-17

GenBank Submission: FJ630342

> BO06315.complete
GAAGTTATCAGTCGACATGTCCTTCGCTCAGTTCTTTGTCGCCTGCTGCC
TGGCCATCGTCCTCCTGGCCGTGTCCAACACACGGGCCGCAGTTCAGGGT
CCACCTCTATGCCAGTCTGGCATCGTCGAGGAGATGCCGCCGCACATCCG
GAAGGTGTGCCAGGCCCTGGAGAACTCCGATCAACTGACGTCGGCGCTGA
AGTCCTACATCAACAACGAGGCATCCGCTTTGGTGGCCAACTCTGATGAC
CTGTTGAAGAACTACAACAAGCGAACGGATGTCGATCACGTCTTCCTGCG
TTTCGGAAAACGTCGTGCAAGCTTTCTAGACCAT

BO06315.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 08:43:10
Subject Length Description Subject Range Query Range Score Percent Strand
Ms-RB 303 CG6440-PB 1..300 17..316 1500 100 Plus
Ms-RC 303 CG6440-PC 1..300 17..316 1500 100 Plus
Ms-RA 303 CG6440-PA 1..300 17..316 1500 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:43:11
Subject Length Description Subject Range Query Range Score Percent Strand
Ms-RB 908 CG6440-RB 114..414 16..316 1505 100 Plus
Ms-RC 1065 CG6440-RC 131..431 16..316 1505 100 Plus
Ms-RA 925 CG6440-RA 131..431 16..316 1505 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 08:43:07
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 24342828..24343039 16..227 1060 100 Plus
3R 32079331 3R 24343102..24343191 227..316 450 100 Plus
Blast to na_te.dros performed on 2014-11-27 08:43:09 has no hits.

BO06315.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:55:03 Download gff for BO06315.complete
Subject Subject Range Query Range Percent Splice Strand
Dms-RA 1..303 17..320 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 05:05:13 Download gff for BO06315.complete
Subject Subject Range Query Range Percent Splice Strand
Dms-RA 122..433 8..321 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:12:59 Download gff for BO06315.complete
Subject Subject Range Query Range Percent Splice Strand
Ms-RA 132..431 17..318 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-04 16:41:34 Download gff for BO06315.complete
Subject Subject Range Query Range Percent Splice Strand
Dms-RA 130..429 17..318 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:25:13 Download gff for BO06315.complete
Subject Subject Range Query Range Percent Splice Strand
Ms-RA 132..431 17..318 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 09:25:13 Download gff for BO06315.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24342829..24343039 17..227 100 -> Plus
3R 24343103..24343191 228..318 97   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:12:59 Download gff for BO06315.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 20168551..20168761 17..227 100 -> Plus
arm_3R 20168825..20168913 228..318 97   Plus

BO06315.pep Sequence

Translation from 16 to 334

> BO06315.pep
MSFAQFFVACCLAIVLLAVSNTRAAVQGPPLCQSGIVEEMPPHIRKVCQA
LENSDQLTSALKSYINNEASALVANSDDLLKNYNKRTDVDHVFLRFGKRR
ASFLDH

BO06315.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:44:56
Subject Length Description Subject Range Query Range Score Percent Strand
Ms-PB 100 CG6440-PB 1..100 1..100 511 100 Plus
Ms-PC 100 CG6440-PC 1..100 1..100 511 100 Plus
Ms-PA 100 CG6440-PA 1..100 1..100 511 100 Plus