Clone BO06404 Report

Search the DGRC for BO06404

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:64
Well:4
Vector:pDNR-Dual
Associated Gene/TranscriptCG4692-RA
Protein status:BO06404.pep: validated full length
Sequenced Size:355

Clone Sequence Records

BO06404.3prime Sequence

353 bp (352 high quality bases) assembled on 2005-12-03

> BO06404.3prime
ATGGTCTAGAAAGCTTGCGTGGTACTTGTAGTTCCTGTGGTGCTTCAACT
TGGTGTAGTTAATCAGATAGAAGAACGTCATGCTGGCGACGGTCAGCTGG
AAGAAGGGAGCGATCCCGGCGCGCTTTGGGAACACGTACTTGTGCTGCCA
GCGCCACCAGGCACGGCTCACAGCTCCGGCCACAGCGTTGGGGGTCTTGT
TGCGGCGTCCCAGCCAGGCGCCGATCTCGCCCAGCTTGACCTGGCCGAAG
GGCACATCGGCTTTGCCGTAGAAGCGAGCGGGGTCGTAGGGCCCGTGCAC
CTTGGGGTTGTACTCAGCTGGATAGTCACCGAATGCCATGTCGACTGATA
ACT

BO06404.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:40:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG4692-PB 324 CG4692-RB 1..321 339..19 1605 100 Minus
CG4692-PA 324 CG4692-RA 1..321 339..19 1605 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 10:33:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG4692-RA 591 CG4692-RA 103..423 339..19 1605 100 Minus
CG4692-RB 548 CG4692-RB 60..380 339..19 1605 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 10:33:13
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 24599256..24599499 19..262 1220 100 Plus
4 1348131 4 976898..977091 219..26 820 94.8 Minus
2R 25286936 2R 24599617..24599695 261..339 395 100 Plus
4 1348131 4 976824..976900 335..259 325 94.8 Minus
Blast to na_te.dros performed on 2015-02-12 10:33:14 has no hits.

BO06404.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 02:48:31 Download gff for BO06404.3prime
Subject Subject Range Query Range Percent Splice Strand
CG4692-PB 1..324 15..339 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 01:20:51 Download gff for BO06404.3prime
Subject Subject Range Query Range Percent Splice Strand
CG4692-PA 1..324 15..339 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 20:58:43 Download gff for BO06404.3prime
Subject Subject Range Query Range Percent Splice Strand
CG4692-RB 56..385 13..343 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 13:04:06 Download gff for BO06404.3prime
Subject Subject Range Query Range Percent Splice Strand
CG4692-RB 56..385 13..343 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 13:04:06 Download gff for BO06404.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 24599617..24599702 261..347 96   Plus
2R 24599251..24599497 13..260 99 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 20:58:43 Download gff for BO06404.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 20487140..20487225 261..347 96   Plus
arm_2R 20486774..20487020 13..260 99 <- Plus

BO06404.5prime Sequence

353 bp (352 high quality bases) assembled on 2005-12-03

> BO06404.5prime
GAAGTTATCAGTCGACATGGCATTCGGTGACTATCCAGCTGAGTACAACC
CCAAGGTGCACGGGCCCTACGACCCCGCTCGCTTCTACGGCAAAGCCGAT
GTGCCCTTCGGCCAGGTCAAGCTGGGCGAGATCGGCGCCTGGCTGGGACG
CCGCAACAAGACCCCCAACGCTGTGGCCGGAGCTGTGAGCCGTGCCTGGT
GGCGCTGGCAGCACAAGTACGTGTTCCCAAAGCGCGCCGGGATCGCTCCC
TTCTTCCAGCTGACCGTCGCCAGCATGACGTTCTTCTATCTGATTAACTA
CACCAAGTTGAAGCACCACAGGAACTACAAGTACCACGCAAGCTTTCTAG
ACC

BO06404.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:40:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG4692-PB 324 CG4692-RB 1..321 17..337 1605 100 Plus
CG4692-PA 324 CG4692-RA 1..321 17..337 1605 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-09 19:13:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG4692-RA 591 CG4692-RA 103..423 17..337 1605 100 Plus
CG4692-RB 548 CG4692-RB 60..380 17..337 1605 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-09 19:13:44
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 24599256..24599499 337..94 1220 100 Minus
4 1348131 4 976898..977091 137..330 820 94.8 Plus
2R 25286936 2R 24599617..24599695 95..17 395 100 Minus
4 1348131 4 976824..976900 21..97 325 94.8 Plus
Blast to na_te.dros performed on 2015-02-09 19:13:48 has no hits.

BO06404.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 02:48:33 Download gff for BO06404.5prime
Subject Subject Range Query Range Percent Splice Strand
CG4692-PB 1..324 17..341 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 01:20:52 Download gff for BO06404.5prime
Subject Subject Range Query Range Percent Splice Strand
CG4692-PA 1..324 17..341 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-13 04:05:52 Download gff for BO06404.5prime
Subject Subject Range Query Range Percent Splice Strand
CG4692-RB 56..385 13..343 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-09 21:18:04 Download gff for BO06404.5prime
Subject Subject Range Query Range Percent Splice Strand
CG4692-RB 56..385 13..343 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-09 21:18:04 Download gff for BO06404.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 24599251..24599497 96..343 99 <- Minus
2R 24599617..24599702 9..95 96   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-13 04:05:52 Download gff for BO06404.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 20486774..20487020 96..343 99 <- Minus
arm_2R 20487140..20487225 9..95 96   Minus

BO06404.complete Sequence

355 bp (355 high quality bases) assembled on 2005-10-27

GenBank Submission: FJ630380

> BO06404.complete
GAAGTTATCAGTCGACATGGCATTCGGTGACTATCCAGCTGAGTACAACC
CCAAGGTGCACGGGCCCTACGACCCCGCTCGCTTCTACGGCAAAGCCGAT
GTGCCCTTCGGCCAGGTCAAGCTGGGCGAGATCGGCGCCTGGCTGGGACG
CCGCAACAAGACCCCCAACGCTGTGGCCGGAGCTGTGAGCCGTGCCTGGT
GGCGCTGGCAGCACAAGTACGTGTTCCCAAAGCGCGCCGGGATCGCTCCC
TTCTTCCAGCTGACCGTCGCCAGCATGACGTTCTTCTATCTGATTAACTA
CACCAAGTTGAAGCACCACAGGAACTACAAGTACCACGCAAGCTTTCTAG
ACCAT

BO06404.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:40:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG4692-RA 324 CG4692-PA 1..321 17..337 1605 100 Plus
CG4692-RB 324 CG4692-PB 1..321 17..337 1605 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:40:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG4692-RA 591 CG4692-RA 103..423 17..337 1605 100 Plus
CG4692-RB 548 CG4692-RB 60..380 17..337 1605 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:40:49
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 24599256..24599499 337..94 1220 100 Minus
4 1348131 4 976898..977091 137..330 820 94.8 Plus
2R 25286936 2R 24599617..24599695 95..17 395 100 Minus
4 1348131 4 976824..976900 21..97 325 94.8 Plus
Blast to na_te.dros performed on 2014-11-27 15:40:49 has no hits.

BO06404.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:24:05 Download gff for BO06404.complete
Subject Subject Range Query Range Percent Splice Strand
CG4692-RA 1..324 17..341 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 06:48:15 Download gff for BO06404.complete
Subject Subject Range Query Range Percent Splice Strand
CG4692-RA 71..403 9..343 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:48:36 Download gff for BO06404.complete
Subject Subject Range Query Range Percent Splice Strand
CG4692-RB 60..380 17..339 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:24:05 Download gff for BO06404.complete
Subject Subject Range Query Range Percent Splice Strand
CG4692-RA 71..403 9..343 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:13:43 Download gff for BO06404.complete
Subject Subject Range Query Range Percent Splice Strand
CG4692-RB 60..380 17..339 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:13:43 Download gff for BO06404.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24599254..24599497 96..339 99 <- Minus
2R 24599617..24599695 17..95 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:48:36 Download gff for BO06404.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 20486777..20487020 96..339 99 <- Minus
arm_2R 20487140..20487218 17..95 100   Minus

BO06404.pep Sequence

Translation from 16 to 355

> BO06404.pep
MAFGDYPAEYNPKVHGPYDPARFYGKADVPFGQVKLGEIGAWLGRRNKTP
NAVAGAVSRAWWRWQHKYVFPKRAGIAPFFQLTVASMTFFYLINYTKLKH
HRNYKYHASFLDH

BO06404.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 19:24:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG4692-PA 107 CG4692-PA 1..107 1..107 604 100 Plus
CG4692-PB 107 CG4692-PB 1..107 1..107 604 100 Plus