Clone BO06666 Report

Search the DGRC for BO06666

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:66
Well:66
Vector:pDNR-Dual
Associated Gene/TranscriptCG10200-RA
Protein status:BO06666.pep: validated full length
Sequenced Size:640

Clone Sequence Records

BO06666.3prime Sequence

638 bp (637 high quality bases) assembled on 2005-12-03

> BO06666.3prime
ATGGTCTAGAAAGCTTGCTTTGGATGAGTAAGTGGATTCGGTCTTCTTGA
TATTGAGAACGCCGTTGGAATCGGTGGCACCCTGGATGTTGGTCACCTTC
TGGTTGCCACTGGCATCGACAACGGCCACGGTCTGCTGGATTTGGGTGGC
GGGAATGGGTCCAACTCCGGAGATGTGCTGATAGCTACCGGTGCTTCCTA
CTCCGCTGTTGCTGCTGATGGAGGCTGCGCTGGTGTAGCCATTGTAGGTG
GGATAATAGTTGTCGCCTCCAGTTAAGGAGCTCTCGCCGAAACGCTCATC
AAAGGACACACCACCAAGCACTGGAGCAGCGGCCTGCTGGGTGTAAGAGG
AGCCAGAATGACCGGAGCCATCGGCATTCTGAACGCTGTGTGAGGCGTAG
GTGAAGACGTTTCCTCCACTGGAGGACGAGGAGGATGATGACGAGGAAGA
CGAACTGGACTGACGACGCAGACGCCTCAGGAGATGGGCATTCACGGGAT
GGACATTCGACTGGTGGCCCTCCGAGTCCAAGGTGAAGAAGGCACGGGGC
AGAAACTGGCCAGCGGAAGAGGCCGAAGCGGTAGTAATCGCAAACAAAGC
GATGGCAATCACAGCGTACTTCATGTCGACTGATAACT

BO06666.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:46:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG10200-PB 609 CG10200-RB 1..606 624..19 3030 100 Minus
CG10200-PA 609 CG10200-RA 1..606 624..19 3030 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-09 19:17:51
Subject Length Description Subject Range Query Range Score Percent Strand
hui-RA 821 CG10200-RA 165..770 624..19 3030 100 Minus
hui-RB 734 CG10200-RB 78..683 624..19 3030 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-09 19:17:42
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 14809585..14809880 314..19 1480 100 Minus
2R 25286936 2R 14809273..14809523 564..314 1255 100 Minus
2R 25286936 2R 14808583..14808643 624..564 305 100 Minus
Blast to na_te.dros performed 2015-02-09 19:17:47
Subject Length Description Subject Range Query Range Score Percent Strand
TART-B 10654 TART-B DM14101 10654bp Derived from U14101 (g603662) (Rel. 42, Last updated, Version 1). 121..169 251..203 119 71.4 Minus
TART-B 10654 TART-B DM14101 10654bp Derived from U14101 (g603662) (Rel. 42, Last updated, Version 1). 9151..9199 251..203 119 71.4 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6763..6824 266..205 111 68.3 Minus
Dbuz\Osvaldo 9045 Dbuz\Osvaldo DBU133521 9045bp Derived from AJ133521 (Rel. 60, Last updated, Version 2). 2169..2269 413..520 108 61.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2325..2403 250..172 106 62.5 Minus

BO06666.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 02:56:10 Download gff for BO06666.3prime
Subject Subject Range Query Range Percent Splice Strand
CG10200-PA 1..609 18..624 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 01:31:09 Download gff for BO06666.3prime
Subject Subject Range Query Range Percent Splice Strand
CG10200-PA 1..609 18..624 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-13 04:06:26 Download gff for BO06666.3prime
Subject Subject Range Query Range Percent Splice Strand
CG10200-RB 73..683 19..633 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-09 21:18:27 Download gff for BO06666.3prime
Subject Subject Range Query Range Percent Splice Strand
hui-RB 73..683 19..633 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-09 21:18:27 Download gff for BO06666.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 14808578..14808643 564..633 94 -> Minus
2R 14809274..14809523 314..563 100 -> Minus
2R 14809586..14809880 19..313 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-13 04:06:26 Download gff for BO06666.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 10696083..10696148 564..633 94 -> Minus
arm_2R 10696779..10697028 314..563 100 -> Minus
arm_2R 10697091..10697385 19..313 100   Minus

BO06666.5prime Sequence

638 bp (637 high quality bases) assembled on 2005-12-03

> BO06666.5prime
GAAGTTATCAGTCGACATGAAGTACGCTGTGATTGCCATCGCTTTGTTTG
CGATTACTACCGCTTCGGCCTCTTCCGCTGGCCAGTTTCTGCCCCGTGCC
TTCTTCACCTTGGACTCGGAGGGCCACCAGTCGAATGTCCATCCCGTGAA
TGCCCATCTCCTGAGGCGTCTGCGTCGTCAGTCCAGTTCGTCTTCCTCGT
CATCATCCTCCTCGTCCTCCAGTGGAGGAAACGTCTTCACCTACGCCTCA
CACAGCGTTCAGAATGCCGATGGCTCCGGTCATTCTGGCTCCTCTTACAC
CCAGCAGGCCGCTGCTCCAGTGCTTGGTGGTGTGTCCTTTGATGAGCGTT
TCGGCGAGAGCTCCTTAACTGGAGGCGACAACTATTATCCCACCTACAAT
GGCTACACCAGCGCAGCCTCCATCAGCAGCAACAGCGGAGTAGGAAGCAC
CGGTAGCTATCAGCACATCTCCGGAGTTGGACCCATTCCCGCCACCCAAA
TCCAGCAGACCGTGGCCGTTGTCGATGCCAGTGGCAACCAGAAGGTGACC
AACATCCAGGGTGCCACCGATTCCAACGGCGTTCTCAATATCAAGAAGAC
CGAATCCACTTACTCATCCAAAGCAAGCTTTCTAGACC

BO06666.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:46:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG10200-PB 609 CG10200-RB 1..606 17..622 3030 100 Plus
CG10200-PA 609 CG10200-RA 1..606 17..622 3030 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 16:14:58
Subject Length Description Subject Range Query Range Score Percent Strand
hui-RA 821 CG10200-RA 165..770 17..622 3030 100 Plus
hui-RB 734 CG10200-RB 78..683 17..622 3030 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 16:14:50
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 14809585..14809880 327..622 1480 100 Plus
2R 25286936 2R 14809273..14809523 77..327 1255 100 Plus
2R 25286936 2R 14808583..14808643 17..77 305 100 Plus
Blast to na_te.dros performed 2015-02-10 16:14:54
Subject Length Description Subject Range Query Range Score Percent Strand
TART-B 10654 TART-B DM14101 10654bp Derived from U14101 (g603662) (Rel. 42, Last updated, Version 1). 121..169 390..438 119 71.4 Plus
TART-B 10654 TART-B DM14101 10654bp Derived from U14101 (g603662) (Rel. 42, Last updated, Version 1). 9151..9199 390..438 119 71.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6763..6824 375..436 111 68.3 Plus
Dbuz\Osvaldo 9045 Dbuz\Osvaldo DBU133521 9045bp Derived from AJ133521 (Rel. 60, Last updated, Version 2). 2169..2269 228..121 108 61.1 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2325..2403 391..469 106 62.5 Plus

BO06666.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 02:56:11 Download gff for BO06666.5prime
Subject Subject Range Query Range Percent Splice Strand
CG10200-PA 1..609 17..623 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 01:31:11 Download gff for BO06666.5prime
Subject Subject Range Query Range Percent Splice Strand
CG10200-PA 1..609 17..623 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-15 06:01:49 Download gff for BO06666.5prime
Subject Subject Range Query Range Percent Splice Strand
CG10200-RB 73..683 8..622 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:16:57 Download gff for BO06666.5prime
Subject Subject Range Query Range Percent Splice Strand
hui-RB 73..683 8..622 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:16:57 Download gff for BO06666.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 14808578..14808643 8..77 94 -> Plus
2R 14809274..14809523 78..327 100 -> Plus
2R 14809586..14809880 328..622 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-15 06:01:49 Download gff for BO06666.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 10696083..10696148 8..77 94 -> Plus
arm_2R 10696779..10697028 78..327 100 -> Plus
arm_2R 10697091..10697385 328..622 100   Plus

BO06666.complete Sequence

640 bp (640 high quality bases) assembled on 2005-11-29

GenBank Submission: FJ630485

> BO06666.complete
GAAGTTATCAGTCGACATGAAGTACGCTGTGATTGCCATCGCTTTGTTTG
CGATTACTACCGCTTCGGCCTCTTCCGCTGGCCAGTTTCTGCCCCGTGCC
TTCTTCACCTTGGACTCGGAGGGCCACCAGTCGAATGTCCATCCCGTGAA
TGCCCATCTCCTGAGGCGTCTGCGTCGTCAGTCCAGTTCGTCTTCCTCGT
CATCATCCTCCTCGTCCTCCAGTGGAGGAAACGTCTTCACCTACGCCTCA
CACAGCGTTCAGAATGCCGATGGCTCCGGTCATTCTGGCTCCTCTTACAC
CCAGCAGGCCGCTGCTCCAGTGCTTGGTGGTGTGTCCTTTGATGAGCGTT
TCGGCGAGAGCTCCTTAACTGGAGGCGACAACTATTATCCCACCTACAAT
GGCTACACCAGCGCAGCCTCCATCAGCAGCAACAGCGGAGTAGGAAGCAC
CGGTAGCTATCAGCACATCTCCGGAGTTGGACCCATTCCCGCCACCCAAA
TCCAGCAGACCGTGGCCGTTGTCGATGCCAGTGGCAACCAGAAGGTGACC
AACATCCAGGGTGCCACCGATTCCAACGGCGTTCTCAATATCAAGAAGAC
CGAATCCACTTACTCATCCAAAGCAAGCTTTCTAGACCAT

BO06666.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 23:33:59
Subject Length Description Subject Range Query Range Score Percent Strand
hui-RA 609 CG10200-PA 1..606 17..622 3030 100 Plus
hui-RB 609 CG10200-PB 1..606 17..622 3030 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 23:34:00
Subject Length Description Subject Range Query Range Score Percent Strand
hui-RA 821 CG10200-RA 165..770 17..622 3030 100 Plus
hui-RB 734 CG10200-RB 78..683 17..622 3030 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 23:33:57
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 14809585..14809880 327..622 1480 100 Plus
2R 25286936 2R 14809273..14809523 77..327 1255 100 Plus
2R 25286936 2R 14808583..14808643 17..77 305 100 Plus
Blast to na_te.dros performed 2014-11-27 23:33:58
Subject Length Description Subject Range Query Range Score Percent Strand
TART-B 10654 TART-B DM14101 10654bp Derived from U14101 (g603662) (Rel. 42, Last updated, Version 1). 121..169 390..438 119 71.4 Plus
TART-B 10654 TART-B DM14101 10654bp Derived from U14101 (g603662) (Rel. 42, Last updated, Version 1). 9151..9199 390..438 119 71.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6763..6824 375..436 111 68.3 Plus
Dbuz\Osvaldo 9045 Dbuz\Osvaldo DBU133521 9045bp Derived from AJ133521 (Rel. 60, Last updated, Version 2). 2169..2269 228..121 108 61.1 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2325..2403 391..469 106 62.5 Plus

BO06666.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:06:29 Download gff for BO06666.complete
Subject Subject Range Query Range Percent Splice Strand
CG10200-RA 1..609 17..623 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:04:21 Download gff for BO06666.complete
Subject Subject Range Query Range Percent Splice Strand
CG10200-RA 130..740 8..622 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:32:01 Download gff for BO06666.complete
Subject Subject Range Query Range Percent Splice Strand
CG10200-RB 78..683 17..624 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:06:29 Download gff for BO06666.complete
Subject Subject Range Query Range Percent Splice Strand
CG10200-RA 130..740 8..622 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:03:24 Download gff for BO06666.complete
Subject Subject Range Query Range Percent Splice Strand
hui-RB 78..683 17..624 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:03:24 Download gff for BO06666.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14809586..14809880 328..624 99   Plus
2R 14808583..14808643 17..77 100 -> Plus
2R 14809274..14809523 78..327 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:32:01 Download gff for BO06666.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 10696088..10696148 17..77 100 -> Plus
arm_2R 10696779..10697028 78..327 100 -> Plus
arm_2R 10697091..10697385 328..624 99   Plus

BO06666.pep Sequence

Translation from 16 to 640

> BO06666.pep
MKYAVIAIALFAITTASASSAGQFLPRAFFTLDSEGHQSNVHPVNAHLLR
RLRRQSSSSSSSSSSSSSSGGNVFTYASHSVQNADGSGHSGSSYTQQAAA
PVLGGVSFDERFGESSLTGGDNYYPTYNGYTSAASISSNSGVGSTGSYQH
ISGVGPIPATQIQQTVAVVDASGNQKVTNIQGATDSNGVLNIKKTESTYS
SKASFLDH

BO06666.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 19:42:23
Subject Length Description Subject Range Query Range Score Percent Strand
hui-PA 202 CG10200-PA 1..202 1..202 1010 100 Plus
hui-PB 202 CG10200-PB 1..202 1..202 1010 100 Plus