Clone BO07661 Report

Search the DGRC for BO07661

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:76
Well:61
Vector:pDNR-Dual
Associated Gene/Transcripteff-RA
Protein status:BO07661.pep: validated full length
Sequenced Size:475

Clone Sequence Records

BO07661.5prime Sequence

473 bp (472 high quality bases) assembled on 2006-01-06

> BO07661.5prime
GAAGTTATCAGTCGACATGGCGTTAAAAAGAATCAATAAGGAACTGCAAG
ATCTGGGCAGAGATCCACCTGCACAATGTTCAGCCGGTCCAGTTGGAGAT
GATTTATTTCACTGGCAAGCTACAATAATGGGCCCGCCGGACAGCCCTTA
TCAAGGAGGTGTATTCTTCTTAACTATACATTTTCCAACAGACTATCCCT
TTAAACCACCCAAAGTGGCTTTTACAACGCGCATATACCATCCAAACATC
AACAGCAATGGATCGATTTGTCTCGATATATTAAGATCTCAGTGGTCGCC
AGCATTAACTATTTCAAAAGTTTTATTATCAATTTGCTCTCTACTCTGTG
ATCCCAATCCAGACGATCCTCTTGTTCCAGAGATTGCCAGAATATATAAA
ACCGATCGGGAAAAATACAATGAGCTGGCACGAGAGTGGACTAGAAAGTA
TGCTATGGCAAGCTTTCTAGACC

BO07661.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 13:07:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG7425-PA 444 eff-RA 1..441 17..457 2205 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-09 19:41:29
Subject Length Description Subject Range Query Range Score Percent Strand
eff-RC 1913 CG7425-RC 389..829 17..457 2205 100 Plus
eff-RB 1622 CG7425-RB 389..829 17..457 2205 100 Plus
eff-RA 2084 CG7425-RA 851..1291 17..457 2205 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-09 19:41:22
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 14733700..14733884 320..136 925 100 Minus
3R 32079331 3R 14733498..14733636 457..319 695 100 Minus
3R 32079331 3R 14737420..14737485 104..39 330 100 Minus
Blast to na_te.dros performed on 2015-02-09 19:41:26 has no hits.

BO07661.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 03:25:35 Download gff for BO07661.5prime
Subject Subject Range Query Range Percent Splice Strand
eff-PA 1..444 17..460 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:10:28 Download gff for BO07661.5prime
Subject Subject Range Query Range Percent Splice Strand
CG7425-PA 1..444 17..460 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-13 04:10:12 Download gff for BO07661.5prime
Subject Subject Range Query Range Percent Splice Strand
eff-RA 843..1301 7..467 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-09 21:21:04 Download gff for BO07661.5prime
Subject Subject Range Query Range Percent Splice Strand
eff-RA 843..1301 7..467 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-09 21:21:04 Download gff for BO07661.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 14737420..14737483 41..104 100 <- Minus
3R 14733488..14733634 321..467 97 <- Minus
3R 14733700..14733883 137..320 100 <- Minus
3R 14734387..14734418 105..136 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-13 04:10:12 Download gff for BO07661.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 10563142..10563205 41..104 100 <- Minus
arm_3R 10559210..10559356 321..467 97 <- Minus
arm_3R 10559422..10559605 137..320 100 <- Minus
arm_3R 10560109..10560140 105..136 100 <- Minus

BO07661.3prime Sequence

473 bp (472 high quality bases) assembled on 2006-01-06

> BO07661.3prime
ATGGTCTAGAAAGCTTGCCATAGCATACTTTCTAGTCCACTCTCGTGCCA
GCTCATTGTATTTTTCCCGATCGGTTTTATATATTCTGGCAATCTCTGGA
ACAAGAGGATCGTCTGGATTGGGATCACAGAGTAGAGAGCAAATTGATAA
TAAAACTTTTGAAATAGTTAATGCTGGCGACCACTGAGATCTTAATATAT
CGAGACAAATCGATCCATTGCTGTTGATGTTTGGATGGTATATGCGCGTT
GTAAAAGCCACTTTGGGTGGTTTAAAGGGATAGTCTGTTGGAAAATGTAT
AGTTAAGAAGAATACACCTCCTTGATAAGGGCTGTCCGGCGGGCCCATTA
TTGTAGCTTGCCAGTGAAATAAATCATCTCCAACTGGACCGGCTGAACAT
TGTGCAGGTGGATCTCTGCCCAGATCTTGCAGTTCCTTATTGATTCTTTT
TAACGCCATGTCGACTGATAACT

BO07661.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 13:07:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG7425-PA 444 eff-RA 1..441 459..19 2205 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 15:53:24
Subject Length Description Subject Range Query Range Score Percent Strand
eff-RC 1913 CG7425-RC 389..829 459..19 2205 100 Minus
eff-RB 1622 CG7425-RB 389..829 459..19 2205 100 Minus
eff-RA 2084 CG7425-RA 851..1291 459..19 2205 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 15:53:16
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 14733700..14733884 156..340 925 100 Plus
3R 32079331 3R 14733498..14733636 19..157 695 100 Plus
3R 32079331 3R 14737420..14737485 372..437 330 100 Plus
Blast to na_te.dros performed on 2015-02-10 15:53:20 has no hits.

BO07661.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 03:25:33 Download gff for BO07661.3prime
Subject Subject Range Query Range Percent Splice Strand
eff-PA 1..444 16..459 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:10:26 Download gff for BO07661.3prime
Subject Subject Range Query Range Percent Splice Strand
CG7425-PA 1..444 16..459 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-15 06:08:03 Download gff for BO07661.3prime
Subject Subject Range Query Range Percent Splice Strand
eff-RA 843..1301 9..469 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:30:48 Download gff for BO07661.3prime
Subject Subject Range Query Range Percent Splice Strand
eff-RA 843..1301 9..469 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:30:48 Download gff for BO07661.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 14733488..14733634 9..155 97 <- Plus
3R 14733700..14733883 156..339 100 <- Plus
3R 14734387..14734418 340..371 100 <- Plus
3R 14737420..14737483 372..435 100 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-15 06:08:03 Download gff for BO07661.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 10559210..10559356 9..155 97 <- Plus
arm_3R 10559422..10559605 156..339 100 <- Plus
arm_3R 10560109..10560140 340..371 100 <- Plus
arm_3R 10563142..10563205 372..435 100 <- Plus

BO07661.complete Sequence

475 bp (475 high quality bases) assembled on 2005-12-21

GenBank Submission: FJ630883

> BO07661.complete
GAAGTTATCAGTCGACATGGCGTTAAAAAGAATCAATAAGGAACTGCAAG
ATCTGGGCAGAGATCCACCTGCACAATGTTCAGCCGGTCCAGTTGGAGAT
GATTTATTTCACTGGCAAGCTACAATAATGGGCCCGCCGGACAGCCCTTA
TCAAGGAGGTGTATTCTTCTTAACTATACATTTTCCAACAGACTATCCCT
TTAAACCACCCAAAGTGGCTTTTACAACGCGCATATACCATCCAAACATC
AACAGCAATGGATCGATTTGTCTCGATATATTAAGATCTCAGTGGTCGCC
AGCATTAACTATTTCAAAAGTTTTATTATCAATTTGCTCTCTACTCTGTG
ATCCCAATCCAGACGATCCTCTTGTTCCAGAGATTGCCAGAATATATAAA
ACCGATCGGGAAAAATACAATGAGCTGGCACGAGAGTGGACTAGAAAGTA
TGCTATGGCAAGCTTTCTAGACCAT

BO07661.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 01:14:15
Subject Length Description Subject Range Query Range Score Percent Strand
eff-RC 444 CG7425-PC 1..441 17..457 2205 100 Plus
eff-RB 444 CG7425-PB 1..441 17..457 2205 100 Plus
eff-RA 444 CG7425-PA 1..441 17..457 2205 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:14:16
Subject Length Description Subject Range Query Range Score Percent Strand
eff-RC 1913 CG7425-RC 389..829 17..457 2205 100 Plus
eff-RB 1622 CG7425-RB 389..829 17..457 2205 100 Plus
eff-RA 2084 CG7425-RA 851..1291 17..457 2205 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 01:14:13
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 14733700..14733884 320..136 925 100 Minus
3R 32079331 3R 14733498..14733636 457..319 695 100 Minus
3R 32079331 3R 14737420..14737485 104..39 330 100 Minus
Blast to na_te.dros performed on 2014-11-28 01:14:14 has no hits.

BO07661.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:07:42 Download gff for BO07661.complete
Subject Subject Range Query Range Percent Splice Strand
eff-RA 1..444 17..460 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 05:23:59 Download gff for BO07661.complete
Subject Subject Range Query Range Percent Splice Strand
eff-RA 735..1193 7..467 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 20:43:21 Download gff for BO07661.complete
Subject Subject Range Query Range Percent Splice Strand
eff-RA 851..1291 17..459 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:07:42 Download gff for BO07661.complete
Subject Subject Range Query Range Percent Splice Strand
eff-RA 735..1193 7..467 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:48:24 Download gff for BO07661.complete
Subject Subject Range Query Range Percent Splice Strand
eff-RA 851..1291 17..459 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:48:24 Download gff for BO07661.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14733495..14733634 321..459 98 <- Minus
3R 14733700..14733883 137..320 100 <- Minus
3R 14734387..14734418 105..136 100 <- Minus
3R 14737420..14737483 41..104 100 <- Minus
3R 14740380..14740403 17..40 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 20:43:21 Download gff for BO07661.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 10560109..10560140 105..136 100 <- Minus
arm_3R 10563142..10563205 41..104 100 <- Minus
arm_3R 10566102..10566125 17..40 100   Minus
arm_3R 10559217..10559356 321..459 98 <- Minus
arm_3R 10559422..10559605 137..320 100 <- Minus

BO07661.pep Sequence

Translation from 16 to 475

> BO07661.pep
MALKRINKELQDLGRDPPAQCSAGPVGDDLFHWQATIMGPPDSPYQGGVF
FLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTIS
KVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREWTRKYAMASF
LDH

BO07661.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 23:44:45
Subject Length Description Subject Range Query Range Score Percent Strand
eff-PC 147 CG7425-PC 1..147 1..147 804 100 Plus
eff-PB 147 CG7425-PB 1..147 1..147 804 100 Plus
eff-PA 147 CG7425-PA 1..147 1..147 804 100 Plus
Ubc2-PD 232 CG6720-PD 89..231 4..146 513 66.4 Plus
Ubc2-PC 232 CG6720-PC 89..231 4..146 513 66.4 Plus