Clone BO09043 Report

Search the DGRC for BO09043

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:90
Well:43
Vector:pDNR-Dual
Associated Gene/Transcriptsar1-RB
Protein status:BO09043.pep: validated not full length
Sequenced Size:499

Clone Sequence Records

BO09043.5prime Sequence

497 bp (496 high quality bases) assembled on 2006-01-10

> BO09043.5prime
GAAGTTATCAGTCGACATGCTCAAAGATGATAAGCTGGCGCAGCATGTGC
CCACACTGCATCCAACATCCGAGGAGCTGTCCATCGGCAACATGCGCTTC
ACTACATTCGACTTGGGTGGCCACACTCAGGCACGACGCGTCTGGAAGGA
CTACTTCCCTGCTGTGGACGCCATCGTTTTCTTAATAGACGCCTGGGACC
GTGGCCGCTTCCAGGAGAGCAAAAACGAGCTGGATTCGCTGCTCACGGAT
GAGGCGCTGTCCAACTGCCCCGTGCTCATATTGGGCAACAAAATCGATAA
GCCCGGCGCGGCTAGCGAGGATGAGCTGAGAAACGTGTTCGGACTGTATC
AGCTAACAACCGGCAAGGGCAAAGTTGCACGCGCCGATTTGCCCGGCCGT
CCTCTGGAATTGTTCATGTGCTCCGTGCTGAAGCGACAGGGCTACGGCGA
GGGTTTCCGTTGGCTGGCGCAGTATATCGATGCAAGCTTTCTAGACC

BO09043.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 13:34:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG7073-PA 582 sar1-RA 115..579 17..481 2325 100 Plus
CG7073-PB 468 sar1-RB 1..465 17..481 2325 100 Plus
CG7073-PD 582 sar1-RD 115..579 17..481 2325 100 Plus
CG7073-PC 582 sar1-RC 115..579 17..481 2325 100 Plus
CG7073-PE 582 sar1-RE 115..579 17..481 2325 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 01:50:09
Subject Length Description Subject Range Query Range Score Percent Strand
Sar1-RE 1452 CG7073-RE 227..691 17..481 2325 100 Plus
Sar1-RC 1801 CG7073-RC 576..1040 17..481 2325 100 Plus
Sar1-RD 1552 CG7073-RD 327..791 17..481 2325 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 01:50:05
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 22359524..22359761 131..368 1190 100 Plus
3R 32079331 3R 22359835..22359950 366..481 580 100 Plus
3R 32079331 3R 22358563..22358628 66..131 330 100 Plus
3R 32079331 3R 22358443..22358491 17..65 245 100 Plus
Blast to na_te.dros performed on 2015-02-13 01:50:07 has no hits.

BO09043.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 04:00:16 Download gff for BO09043.5prime
Subject Subject Range Query Range Percent Splice Strand
sar1-PA 115..582 17..485 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 03:00:00 Download gff for BO09043.5prime
Subject Subject Range Query Range Percent Splice Strand
CG7073-PE 115..582 17..485 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-01 15:29:06 Download gff for BO09043.5prime
Subject Subject Range Query Range Percent Splice Strand
Sar1-RA 278..746 17..486 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 03:13:00 Download gff for BO09043.5prime
Subject Subject Range Query Range Percent Splice Strand
Sar1-RD 327..795 17..486 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 03:13:00 Download gff for BO09043.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 22358443..22358491 17..65 100 -> Plus
3R 22358563..22358628 66..131 100 -> Plus
3R 22359525..22359760 132..367 100 -> Plus
3R 22359837..22359954 368..486 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-01 15:29:06 Download gff for BO09043.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 18184165..18184213 17..65 100 -> Plus
arm_3R 18184285..18184350 66..131 100 -> Plus
arm_3R 18185247..18185482 132..367 100 -> Plus
arm_3R 18185559..18185676 368..486 98   Plus

BO09043.3prime Sequence

497 bp (496 high quality bases) assembled on 2006-01-10

> BO09043.3prime
ATGGTCTAGAAAGCTTGCATCGATATACTGCGCCAGCCAACGGAAACCCT
CGCCGTAGCCCTGTCGCTTCAGCACGGAGCACATGAACAATTCCAGAGGA
CGGCCGGGCAAATCGGCGCGTGCAACTTTGCCCTTGCCGGTTGTTAGCTG
ATACAGTCCGAACACGTTTCTCAGCTCATCCTCGCTAGCCGCGCCGGGCT
TATCGATTTTGTTGCCCAATATGAGCACGGGGCAGTTGGACAGCGCCTCA
TCCGTGAGCAGCGAATCCAGCTCGTTTTTGCTCTCCTGGAAGCGGCCACG
GTCCCAGGCGTCTATTAAGAAAACGATGGCGTCCACAGCAGGGAAGTAGT
CCTTCCAGACGCGTCGTGCCTGAGTGTGGCCACCCAAGTCGAATGTAGTG
AAGCGCATGTTGCCGATGGACAGCTCCTCGGATGTTGGATGCAGTGTGGG
CACATGCTGCGCCAGCTTATCATCTTTGAGCATGTCGACTGATAACT

BO09043.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 13:34:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG7073-PA 582 sar1-RA 115..579 483..19 2325 100 Minus
CG7073-PB 468 sar1-RB 1..465 483..19 2325 100 Minus
CG7073-PD 582 sar1-RD 115..579 483..19 2325 100 Minus
CG7073-PC 582 sar1-RC 115..579 483..19 2325 100 Minus
CG7073-PE 582 sar1-RE 115..579 483..19 2325 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-01 07:01:23
Subject Length Description Subject Range Query Range Score Percent Strand
Sar1-RE 1452 CG7073-RE 227..691 483..19 2325 100 Minus
Sar1-RC 1801 CG7073-RC 576..1040 483..19 2325 100 Minus
Sar1-RD 1552 CG7073-RD 327..791 483..19 2325 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-01 07:01:18
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 22359524..22359761 369..132 1190 100 Minus
3R 32079331 3R 22359835..22359950 134..19 580 100 Minus
3R 32079331 3R 22358563..22358628 434..369 330 100 Minus
3R 32079331 3R 22358443..22358491 483..435 245 100 Minus
Blast to na_te.dros performed on 2015-02-01 07:01:21 has no hits.

BO09043.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 04:00:15 Download gff for BO09043.3prime
Subject Subject Range Query Range Percent Splice Strand
sar1-PA 115..582 15..483 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:59:59 Download gff for BO09043.3prime
Subject Subject Range Query Range Percent Splice Strand
CG7073-PE 115..582 15..483 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-07 15:09:52 Download gff for BO09043.3prime
Subject Subject Range Query Range Percent Splice Strand
Sar1-RA 278..746 14..483 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-01 09:40:13 Download gff for BO09043.3prime
Subject Subject Range Query Range Percent Splice Strand
Sar1-RD 327..795 14..483 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-01 09:40:13 Download gff for BO09043.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 22358443..22358491 435..483 100 -> Minus
3R 22358563..22358628 369..434 100 -> Minus
3R 22359525..22359760 133..368 100 -> Minus
3R 22359837..22359954 14..132 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-07 15:09:52 Download gff for BO09043.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 18184165..18184213 435..483 100 -> Minus
arm_3R 18184285..18184350 369..434 100 -> Minus
arm_3R 18185247..18185482 133..368 100 -> Minus
arm_3R 18185559..18185676 14..132 98   Minus

BO09043.complete Sequence

499 bp (499 high quality bases) assembled on 2006-01-25

GenBank Submission: FJ631364

> BO09043.complete
GAAGTTATCAGTCGACATGCTCAAAGATGATAAGCTGGCGCAGCATGTGC
CCACACTGCATCCAACATCCGAGGAGCTGTCCATCGGCAACATGCGCTTC
ACTACATTCGACTTGGGTGGCCACACTCAGGCACGACGCGTCTGGAAGGA
CTACTTCCCTGCTGTGGACGCCATCGTTTTCTTAATAGACGCCTGGGACC
GTGGCCGCTTCCAGGAGAGCAAAAACGAGCTGGATTCGCTGCTCACGGAT
GAGGCGCTGTCCAACTGCCCCGTGCTCATATTGGGCAACAAAATCGATAA
GCCCGGCGCGGCTAGCGAGGATGAGCTGAGAAACGTGTTCGGACTGTATC
AGCTAACAACCGGCAAGGGCAAAGTTGCACGCGCCGATTTGCCCGGCCGT
CCTCTGGAATTGTTCATGTGCTCCGTGCTGAAGCGACAGGGCTACGGCGA
GGGTTTCCGTTGGCTGGCGCAGTATATCGATGCAAGCTTTCTAGACCAT

BO09043.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 00:01:59
Subject Length Description Subject Range Query Range Score Percent Strand
Sar1-RE 582 CG7073-PE 115..579 17..481 2325 100 Plus
Sar1-RC 582 CG7073-PC 115..579 17..481 2325 100 Plus
Sar1-RD 582 CG7073-PD 115..579 17..481 2325 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 00:02:00
Subject Length Description Subject Range Query Range Score Percent Strand
Sar1-RE 1452 CG7073-RE 227..691 17..481 2325 100 Plus
Sar1-RC 1801 CG7073-RC 576..1040 17..481 2325 100 Plus
Sar1-RD 1552 CG7073-RD 327..791 17..481 2325 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 00:01:57
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 22359524..22359761 131..368 1190 100 Plus
3R 32079331 3R 22359835..22359950 366..481 580 100 Plus
3R 32079331 3R 22358563..22358628 66..131 330 100 Plus
3R 32079331 3R 22358443..22358491 17..65 245 100 Plus
Blast to na_te.dros performed on 2014-11-28 00:01:58 has no hits.

BO09043.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:46:48 Download gff for BO09043.complete
Subject Subject Range Query Range Percent Splice Strand
sar1-RD 115..582 17..485 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 06:01:04 Download gff for BO09043.complete
Subject Subject Range Query Range Percent Splice Strand
sar1-RD 391..859 17..486 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:44:04 Download gff for BO09043.complete
Subject Subject Range Query Range Percent Splice Strand
Sar1-RA 278..742 17..483 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:46:49 Download gff for BO09043.complete
Subject Subject Range Query Range Percent Splice Strand
sar1-RD 391..859 17..486 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:13:08 Download gff for BO09043.complete
Subject Subject Range Query Range Percent Splice Strand
Sar1-RD 327..791 17..483 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:13:08 Download gff for BO09043.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22358443..22358491 17..65 100 -> Plus
3R 22358563..22358628 66..131 100 -> Plus
3R 22359525..22359760 132..367 100 -> Plus
3R 22359837..22359950 368..483 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:44:04 Download gff for BO09043.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 18184165..18184213 17..65 100 -> Plus
arm_3R 18184285..18184350 66..131 100 -> Plus
arm_3R 18185247..18185482 132..367 100 -> Plus
arm_3R 18185559..18185672 368..483 98   Plus

BO09043.pep Sequence

Translation from 16 to 499

> BO09043.pep
MLKDDKLAQHVPTLHPTSEELSIGNMRFTTFDLGGHTQARRVWKDYFPAV
DAIVFLIDAWDRGRFQESKNELDSLLTDEALSNCPVLILGNKIDKPGAAS
EDELRNVFGLYQLTTGKGKVARADLPGRPLELFMCSVLKRQGYGEGFRWL
AQYIDASFLDH

BO09043.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 19:50:42
Subject Length Description Subject Range Query Range Score Percent Strand
Sar1-PE 193 CG7073-PE 39..193 1..155 819 100 Plus
Sar1-PC 193 CG7073-PC 39..193 1..155 819 100 Plus
Sar1-PD 193 CG7073-PD 39..193 1..155 819 100 Plus
Sar1-PA 193 CG7073-PA 39..193 1..155 819 100 Plus
Arl1-PA 180 CG6025-PA 45..178 11..156 201 29.5 Plus