Clone BO11467 Report

Search the DGRC for BO11467

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:114
Well:67
Vector:pDNR-Dual
Associated Gene/TranscriptCG13364-RA
Protein status:BO11467.pep: validated full length
Sequenced Size:226

Clone Sequence Records

BO11467.3prime Sequence

224 bp (223 high quality bases) assembled on 2006-04-19

> BO11467.3prime
ATGGTCTAGAAAGCTTGCCTTCTTTCCCGACTTCTTGATGCCGCCTCCTA
CGAGAGGACCCTTCTTTGAGGCGTTCGCCTTGGCCGCCTCCAGAGCCTTC
TGCTGCTCCTTCTGCTTTTGCTTGAAGGCCATGTCGTCCTCGTCCAGGTC
TTTGGAGTCCTTCTTCGGCGCCTTCAGAGGCTTCTTCTTACCGCCCTCGC
GTCCAGACATGTCGACTGATAACT

BO11467.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 14:23:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG13364-PA 195 CG13364-RA 1..192 210..19 960 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 02:15:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG13364-RA 387 CG13364-RA 54..252 210..12 965 99 Minus
CG16824-RA 407 CG16824-RA 71..262 210..19 555 85.9 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 02:15:35
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 624892..625090 12..210 965 99 Plus
2L 23513712 2L 13293079..13293270 210..19 555 85.9 Minus
Blast to na_te.dros performed on 2015-02-13 02:15:37 has no hits.

BO11467.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 05:07:25 Download gff for BO11467.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13364-PA 1..195 16..210 98   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 04:31:32 Download gff for BO11467.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13364-PA 1..195 16..210 98   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-01 15:29:55 Download gff for BO11467.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13364-RA 47..252 12..217 97   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 03:34:15 Download gff for BO11467.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13364-RA 47..252 12..217 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 03:34:15 Download gff for BO11467.3prime
Subject Subject Range Query Range Percent Splice Strand
X 624892..625093 12..217 97   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-01 15:29:55 Download gff for BO11467.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 518925..519126 12..217 97   Plus

BO11467.5prime Sequence

224 bp (223 high quality bases) assembled on 2006-04-19

> BO11467.5prime
GAAGTTATCAGTCGACATGTCTGGACGCGAGGGCGGTAAGAAGAAGCCTC
TGAAGGCGCCGAAGAAGGACTCCAAAGACCTGGACGAGGACGACATGGCC
TTCAAGCAAAAGCAGAAGGAGCAGCAGAAGGCTCTGGAGGCGGCCAAGGC
GAACGCCTCAAAGAAGGGTCCTCTCGTAGGAGGCGGCATCAAGAAGTCGG
GAAAGAAGGCAAGCTTTCTAGACC

BO11467.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 14:23:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG13364-PA 195 CG13364-RA 1..192 17..208 960 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 10:24:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG13364-RA 387 CG13364-RA 54..252 17..215 965 99 Plus
CG16824-RA 407 CG16824-RA 71..262 17..208 555 85.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 10:24:05
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 624892..625090 215..17 965 99 Minus
2L 23513712 2L 13293079..13293270 17..208 555 85.9 Plus
Blast to na_te.dros performed on 2015-02-11 10:24:07 has no hits.

BO11467.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 05:07:27 Download gff for BO11467.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13364-PA 1..195 17..211 98   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 04:31:34 Download gff for BO11467.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13364-PA 1..195 17..211 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-24 03:05:17 Download gff for BO11467.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13364-RA 47..252 10..215 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 12:24:54 Download gff for BO11467.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13364-RA 47..252 10..215 97   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 12:24:54 Download gff for BO11467.5prime
Subject Subject Range Query Range Percent Splice Strand
X 624892..625093 10..215 97   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-24 03:05:17 Download gff for BO11467.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 518925..519126 10..215 97   Minus

BO11467.complete Sequence

226 bp assembled on 2006-10-10

GenBank Submission: FJ632092

> BO11467.complete
GAAGTTATCAGTCGACATGTCTGGACGCGAGGGCGGTAAGAAGAAGCCTC
TGAAGGCGCCGAAGAAGGACTCCAAAGACCTGGACGAGGACGACATGGCC
TTCAAGCAAAAGCAGAAGGAGCAGCAGAAGGCTCTGGAGGCGGCCAAGGC
GAACGCCTCAAAGAAGGGTCCTCTCGTAGGAGGCGGCATCAAGAAGTCGG
GAAAGAAGGCAAGCTTTCTAGACCAT

BO11467.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 01:14:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG13364-RA 195 CG13364-PA 1..192 17..208 960 100 Plus
CG16824-RA 195 CG16824-PA 1..192 17..208 555 85.9 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:14:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG13364-RA 387 CG13364-RA 54..252 17..215 965 99 Plus
CG16824-RA 407 CG16824-RA 71..262 17..208 555 85.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 01:14:10
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 624892..625090 215..17 965 99 Minus
2L 23513712 2L 13293079..13293270 17..208 555 85.9 Plus
Blast to na_te.dros performed on 2014-11-28 01:14:11 has no hits.

BO11467.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:26:35 Download gff for BO11467.complete
Subject Subject Range Query Range Percent Splice Strand
CG13364-RA 1..195 17..211 98   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 05:46:39 Download gff for BO11467.complete
Subject Subject Range Query Range Percent Splice Strand
CG13364-RA 45..250 10..215 97   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 20:43:19 Download gff for BO11467.complete
Subject Subject Range Query Range Percent Splice Strand
CG13364-RA 54..245 17..210 98   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:26:35 Download gff for BO11467.complete
Subject Subject Range Query Range Percent Splice Strand
CG13364-RA 45..250 10..215 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:48:22 Download gff for BO11467.complete
Subject Subject Range Query Range Percent Splice Strand
CG13364-RA 54..245 17..210 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:48:22 Download gff for BO11467.complete
Subject Subject Range Query Range Percent Splice Strand
X 624896..625090 17..210 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 20:43:19 Download gff for BO11467.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 518929..519123 17..210 98   Minus

BO11467.pep Sequence

Translation from 16 to 226

> BO11467.pep
MSGREGGKKKPLKAPKKDSKDLDEDDMAFKQKQKEQQKALEAAKANASKK
GPLVGGGIKKSGKKASFLDH

BO11467.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 23:56:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG13364-PA 64 CG13364-PA 1..64 1..64 324 100 Plus
CG16824-PA 64 CG16824-PA 1..64 1..64 301 90.6 Plus