Clone BO11471 Report

Search the DGRC for BO11471

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:114
Well:71
Vector:pDNR-Dual
Associated Gene/TranscriptDrs-RA
Protein status:BO11471.pep:
Sequenced Size:244

Clone Sequence Records

BO11471.3prime Sequence

242 bp (241 high quality bases) assembled on 2006-04-19

> BO11471.3prime
ATGGTCTAGAAAGCTTGCGCATCCTTCGCACCAGCACTTCAGACTGGGGC
TGCAGTGGCCACTGGAGCGTCCCTCCTCCTTGCACACACGACGACAGGTC
TCGTTGTCCCAGACGGCACAGGGACCCTTGTATCTTCCGGACAGGCAGTC
GGCATCGGCCTCGTTGGCTCCCAGGACCACCAGCATCAGGACAGCGAAGA
GGGCGAACAAGTACTTGATCTGCATCATGTCGACTGATAACT

BO11471.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 14:23:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG10810-PA 213 Drs-RA 1..210 228..19 1050 100 Minus
CG10812-PA 210 dro5-RA 103..207 123..19 375 94.2 Minus
CG32268-PA 219 dro6-RA 53..131 176..98 220 91.1 Minus
CG32279-PA 213 dro2-RA 165..210 64..19 180 95.6 Minus
CG32279-PA 213 dro2-RA 73..130 156..99 165 91.3 Minus
CG32274-PA 210 Drs-l-RA 161..207 65..19 160 93.6 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 22:23:11
Subject Length Description Subject Range Query Range Score Percent Strand
Drs-RA 387 CG10810-RA 64..273 228..19 1050 100 Minus
Drsl5-RA 364 CG10812-RA 104..261 176..19 550 89.9 Minus
Drsl2-RA 333 CG32279-RA 17..236 238..19 470 80.9 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 22:23:04
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 3369619..3369828 228..19 1050 100 Minus
3L 28110227 3L 3316884..3317041 176..19 550 89.9 Minus
3L 28110227 3L 3314365..3314584 238..19 470 80.9 Minus
3L 28110227 3L 3336202..3336362 68..228 400 83.2 Plus
3L 28110227 3L 3335582..3335759 19..196 245 75.8 Plus
3L 28110227 3L 3315784..3315843 84..25 180 86.7 Minus
Blast to na_te.dros performed on 2015-02-10 22:23:07 has no hits.

BO11471.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 05:07:34 Download gff for BO11471.3prime
Subject Subject Range Query Range Percent Splice Strand
Drs-PA 1..213 15..228 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 04:31:43 Download gff for BO11471.3prime
Subject Subject Range Query Range Percent Splice Strand
CG10810-PA 1..213 15..228 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-21 19:56:03 Download gff for BO11471.3prime
Subject Subject Range Query Range Percent Splice Strand
Drs-RA 64..276 15..228 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 00:01:17 Download gff for BO11471.3prime
Subject Subject Range Query Range Percent Splice Strand
Drs-RA 64..276 15..228 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 00:01:17 Download gff for BO11471.3prime
Subject Subject Range Query Range Percent Splice Strand
3L 3369619..3369831 15..228 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-21 19:56:03 Download gff for BO11471.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 3369619..3369831 15..228 99   Minus

BO11471.5prime Sequence

242 bp (241 high quality bases) assembled on 2006-04-19

> BO11471.5prime
GAAGTTATCAGTCGACATGATGCAGATCAAGTACTTGTTCGCCCTCTTCG
CTGTCCTGATGCTGGTGGTCCTGGGAGCCAACGAGGCCGATGCCGACTGC
CTGTCCGGAAGATACAAGGGTCCCTGTGCCGTCTGGGACAACGAGACCTG
TCGTCGTGTGTGCAAGGAGGAGGGACGCTCCAGTGGCCACTGCAGCCCCA
GTCTGAAGTGCTGGTGCGAAGGATGCGCAAGCTTTCTAGACC

BO11471.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 14:23:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG10810-PA 213 Drs-RA 1..210 17..226 1050 100 Plus
CG10812-PA 210 dro5-RA 103..207 122..226 375 94.2 Plus
CG32268-PA 219 dro6-RA 53..131 69..147 220 91.1 Plus
CG32279-PA 213 dro2-RA 165..210 181..226 180 95.6 Plus
CG32279-PA 213 dro2-RA 73..130 89..146 165 91.3 Plus
CG32274-PA 210 Drs-l-RA 161..207 180..226 160 93.6 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 15:56:31
Subject Length Description Subject Range Query Range Score Percent Strand
Drs-RA 387 CG10810-RA 64..273 17..226 1050 100 Plus
Drsl5-RA 364 CG10812-RA 104..261 69..226 550 89.9 Plus
Drsl2-RA 333 CG32279-RA 17..236 7..226 470 80.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 15:56:24
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 3369619..3369828 17..226 1050 100 Plus
3L 28110227 3L 3316884..3317041 69..226 550 89.9 Plus
3L 28110227 3L 3314365..3314584 7..226 470 80.9 Plus
3L 28110227 3L 3336202..3336362 177..17 400 83.2 Minus
3L 28110227 3L 3335582..3335759 226..49 245 75.8 Minus
3L 28110227 3L 3315784..3315843 161..220 180 86.7 Plus
Blast to na_te.dros performed on 2015-02-10 15:56:28 has no hits.

BO11471.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 05:07:35 Download gff for BO11471.5prime
Subject Subject Range Query Range Percent Splice Strand
Drs-PA 1..213 17..230 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 04:31:44 Download gff for BO11471.5prime
Subject Subject Range Query Range Percent Splice Strand
CG10810-PA 1..213 17..230 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-14 15:00:05 Download gff for BO11471.5prime
Subject Subject Range Query Range Percent Splice Strand
Drs-RA 64..276 17..230 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:07:35 Download gff for BO11471.5prime
Subject Subject Range Query Range Percent Splice Strand
Drs-RA 64..276 17..230 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:07:35 Download gff for BO11471.5prime
Subject Subject Range Query Range Percent Splice Strand
3L 3369619..3369831 17..230 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-14 15:00:05 Download gff for BO11471.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 3369619..3369831 17..230 99   Plus

BO11471.complete Sequence

244 bp assembled on 2007-06-22

GenBank Submission: FJ632093

> BO11471.complete
GAAGTTATCAGTCGACATGATGCAGATCAAGTACTTGTTCGCCCTCTTCG
CTGTCCTGATGCTGGTGGTCCTGGGAGCCAACGAGGCCGATGCCGACTGC
CTGTCCGGAAGATACAAGGGTCCCTGTGCCGTCTGGGACAACGAGACCTG
TCGTCGTGTGTGCAAGGAGGAGGGACGCTCCAGTGGCCACTGCAGCCCCA
GTCTGAAGTGCTGGTGCGAAGGATGCGCAAGCTTTCTAGACCAT

BO11471.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:36:54
Subject Length Description Subject Range Query Range Score Percent Strand
Drs-RA 213 CG10810-PA 1..210 17..226 1050 100 Plus
Drsl5-RA 210 CG10812-PA 50..207 69..226 550 89.9 Plus
Drsl2-RA 213 CG32279-PA 1..210 17..226 465 81.4 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:36:55
Subject Length Description Subject Range Query Range Score Percent Strand
Drs-RA 387 CG10810-RA 64..273 17..226 1050 100 Plus
Drsl5-RA 364 CG10812-RA 104..261 69..226 550 89.9 Plus
Drsl2-RA 333 CG32279-RA 17..236 7..226 470 80.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:36:52
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 3369619..3369828 17..226 1050 100 Plus
3L 28110227 3L 3316884..3317041 69..226 550 89.9 Plus
3L 28110227 3L 3314365..3314584 7..226 470 80.9 Plus
3L 28110227 3L 3336202..3336362 177..17 400 83.2 Minus
3L 28110227 3L 3335582..3335759 226..49 245 75.8 Minus
3L 28110227 3L 3315784..3315843 161..220 180 86.7 Plus
Blast to na_te.dros performed on 2014-11-26 15:36:53 has no hits.

BO11471.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:08:48 Download gff for BO11471.complete
Subject Subject Range Query Range Percent Splice Strand
Drs-RA 1..213 17..230 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:01:46 Download gff for BO11471.complete
Subject Subject Range Query Range Percent Splice Strand
Drs-RA 51..263 17..230 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:02:53 Download gff for BO11471.complete
Subject Subject Range Query Range Percent Splice Strand
Drs-RA 64..273 17..228 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:08:48 Download gff for BO11471.complete
Subject Subject Range Query Range Percent Splice Strand
Drs-RA 51..263 17..230 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:45:28 Download gff for BO11471.complete
Subject Subject Range Query Range Percent Splice Strand
Drs-RA 64..273 17..228 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:45:28 Download gff for BO11471.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3369619..3369828 17..228 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:02:53 Download gff for BO11471.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 3369619..3369828 17..228 99   Plus

BO11471.pep Sequence

Translation from 16 to 244

> BO11471.pep
MMQIKYLFALFAVLMLVVLGANEADADCLSGRYKGPCAVWDNETCRRVCK
EEGRSSGHCSPSLKCWCEGCASFLDH

BO11471.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 23:45:53
Subject Length Description Subject Range Query Range Score Percent Strand
Drs-PA 70 CG10810-PA 1..70 1..70 394 100 Plus
Drsl5-PA 69 CG10812-PA 1..69 2..70 338 82.6 Plus
Drsl2-PA 70 CG32279-PA 1..70 1..70 328 78.6 Plus
Drsl6-PA 72 CG32268-PA 1..72 1..70 324 77.8 Plus
Drsl1-PA 69 CG32274-PA 1..69 2..70 278 66.7 Plus