Clone BO11472 Report

Search the DGRC for BO11472

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:114
Well:72
Vector:pDNR-Dual
Associated Gene/TranscriptCG8750-RA
Protein status:BO11472.pep: validated full length
Sequenced Size:262

Clone Sequence Records

BO11472.3prime Sequence

260 bp (259 high quality bases) assembled on 2006-04-19

> BO11472.3prime
ATGGTCTAGAAAGCTTGCGACTTGGCCTGAAGACTTCCACTCTTGGACAC
GTCTCTGCAGAGTCTGCAAGCGACTGCCCAGATCTTCGGATATTTTTGGG
TTGTTCTTGGCCAAGAAGTTCTGCTGCTGCATGCTGGCCACGTTCAAAGG
ACCTAGTATCCTTCCAGTCGTTGGTCGCTCTATCTTGATGACTCGAGGCT
GTTGCTCTGACACAGGCATCTTGCGCCGATTTGGAATCTTAAGCATGTCG
ACTGATAACT

BO11472.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 14:23:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG8750-PA 231 CG8750-RA 1..228 246..19 1140 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-06 18:34:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG8750-RB 641 CG8750-RB 128..355 246..19 1140 100 Minus
CG8750-RA 452 CG8750-RA 128..355 246..19 1140 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-06 18:34:12
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 13842663..13842890 19..246 1140 100 Plus
Blast to na_te.dros performed on 2015-02-06 18:34:15 has no hits.

BO11472.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 05:07:36 Download gff for BO11472.3prime
Subject Subject Range Query Range Percent Splice Strand
CG8750-PA 1..231 16..246 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 04:31:45 Download gff for BO11472.3prime
Subject Subject Range Query Range Percent Splice Strand
CG8750-PA 1..231 16..246 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-11 10:40:40 Download gff for BO11472.3prime
Subject Subject Range Query Range Percent Splice Strand
CG8750-RA 128..355 19..246 100   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-06 19:45:04 Download gff for BO11472.3prime
Subject Subject Range Query Range Percent Splice Strand
CG8750-RA 128..355 19..246 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-06 19:45:04 Download gff for BO11472.3prime
Subject Subject Range Query Range Percent Splice Strand
3L 13842663..13842890 19..246 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-11 10:40:40 Download gff for BO11472.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 13835763..13835990 19..246 100   Plus

BO11472.5prime Sequence

260 bp (259 high quality bases) assembled on 2006-04-19

> BO11472.5prime
GAAGTTATCAGTCGACATGCTTAAGATTCCAAATCGGCGCAAGATGCCTG
TGTCAGAGCAACAGCCTCGAGTCATCAAGATAGAGCGACCAACGACTGGA
AGGATACTAGGTCCTTTGAACGTGGCCAGCATGCAGCAGCAGAACTTCTT
GGCCAAGAACAACCCAAAAATATCCGAAGATCTGGGCAGTCGCTTGCAGA
CTCTGCAGAGACGTGTCCAAGAGTGGAAGTCTTCAGGCCAAGTCGCAAGC
TTTCTAGACC

BO11472.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 14:23:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG8750-PA 231 CG8750-RA 1..228 17..244 1140 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 10:20:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG8750-RB 641 CG8750-RB 128..355 17..244 1140 100 Plus
CG8750-RA 452 CG8750-RA 128..355 17..244 1140 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 10:20:22
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 13842663..13842890 244..17 1140 100 Minus
Blast to na_te.dros performed on 2015-02-11 10:20:24 has no hits.

BO11472.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 05:07:37 Download gff for BO11472.5prime
Subject Subject Range Query Range Percent Splice Strand
CG8750-PA 1..231 17..247 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 04:31:47 Download gff for BO11472.5prime
Subject Subject Range Query Range Percent Splice Strand
CG8750-PA 1..231 17..247 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-24 03:04:43 Download gff for BO11472.5prime
Subject Subject Range Query Range Percent Splice Strand
CG8750-RA 128..355 17..244 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 12:17:07 Download gff for BO11472.5prime
Subject Subject Range Query Range Percent Splice Strand
CG8750-RA 128..355 17..244 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 12:17:07 Download gff for BO11472.5prime
Subject Subject Range Query Range Percent Splice Strand
3L 13842663..13842890 17..244 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-24 03:04:43 Download gff for BO11472.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 13835763..13835990 17..244 100   Minus

BO11472.complete Sequence

262 bp assembled on 2006-10-10

GenBank Submission: FJ632094

> BO11472.complete
GAAGTTATCAGTCGACATGCTTAAGATTCCAAATCGGCGCAAGATGCCTG
TGTCAGAGCAACAGCCTCGAGTCATCAAGATAGAGCGACCAACGACTGGA
AGGATACTAGGTCCTTTGAACGTGGCCAGCATGCAGCAGCAGAACTTCTT
GGCCAAGAACAACCCAAAAATATCCGAAGATCTGGGCAGTCGCTTGCAGA
CTCTGCAGAGACGTGTCCAAGAGTGGAAGTCTTCAGGCCAAGTCGCAAGC
TTTCTAGACCAT

BO11472.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:30:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG8750-RB 231 CG8750-PB 1..228 17..244 1140 100 Plus
CG8750-RA 231 CG8750-PA 1..228 17..244 1140 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:30:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG8750-RB 641 CG8750-RB 128..355 17..244 1140 100 Plus
CG8750-RA 452 CG8750-RA 128..355 17..244 1140 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:30:13
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 13842663..13842890 244..17 1140 100 Minus
Blast to na_te.dros performed on 2014-11-27 13:30:14 has no hits.

BO11472.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:27:11 Download gff for BO11472.complete
Subject Subject Range Query Range Percent Splice Strand
CG8750-RA 1..231 17..247 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 05:46:53 Download gff for BO11472.complete
Subject Subject Range Query Range Percent Splice Strand
CG8750-RA 128..355 17..244 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:30:11 Download gff for BO11472.complete
Subject Subject Range Query Range Percent Splice Strand
CG8750-RA 128..355 17..246 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:27:12 Download gff for BO11472.complete
Subject Subject Range Query Range Percent Splice Strand
CG8750-RA 128..355 17..244 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:19:55 Download gff for BO11472.complete
Subject Subject Range Query Range Percent Splice Strand
CG8750-RA 128..355 17..246 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:19:55 Download gff for BO11472.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13842660..13842890 17..246 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:30:11 Download gff for BO11472.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 13835760..13835990 17..246 99   Minus

BO11472.pep Sequence

Translation from 16 to 262

> BO11472.pep
MLKIPNRRKMPVSEQQPRVIKIERPTTGRILGPLNVASMQQQNFLAKNNP
KISEDLGSRLQTLQRRVQEWKSSGQVASFLDH

BO11472.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 23:55:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG8750-PB 76 CG8750-PB 1..76 1..76 384 100 Plus
CG8750-PA 76 CG8750-PA 1..76 1..76 384 100 Plus