Clone BO11474 Report

Search the DGRC for BO11474

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:114
Well:74
Vector:pDNR-Dual
Associated Gene/TranscriptMtnA-RA
Protein status:BO11474.pep:
Sequenced Size:154

Clone Sequence Records

BO11474.3prime Sequence

152 bp (151 high quality bases) assembled on 2006-04-19

> BO11474.3prime
ATGGTCTAGAAAGCTTGCCTCGGAGCAGCCGCAGGCGGATTTCTTGTCGC
CGCCGCACTTGCAGTCAGATCCGCAGTTGCAGGATCCCTTGGTGGCCTGG
CTGGCGCATTTGCATCCGCTTCCGCATGGGCAAGGCATGTCGACTGATAA
CT

BO11474.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 14:23:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG9470-PA 123 MtnA-RA 1..120 138..19 600 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 11:32:18
Subject Length Description Subject Range Query Range Score Percent Strand
MtnA-RB 700 CG9470-RB 126..245 138..19 600 100 Minus
MtnA-RA 329 CG9470-RA 126..245 138..19 600 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 11:32:12
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 9783862..9783960 19..117 495 100 Plus
Blast to na_te.dros performed on 2015-02-12 11:32:15 has no hits.

BO11474.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 05:07:38 Download gff for BO11474.3prime
Subject Subject Range Query Range Percent Splice Strand
MtnA-PA 1..123 16..138 98   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 04:31:48 Download gff for BO11474.3prime
Subject Subject Range Query Range Percent Splice Strand
CG9470-PA 1..123 16..138 98   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-30 02:11:31 Download gff for BO11474.3prime
Subject Subject Range Query Range Percent Splice Strand
MtnA-RA 117..254 9..147 95   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 13:37:02 Download gff for BO11474.3prime
Subject Subject Range Query Range Percent Splice Strand
MtnA-RA 117..254 9..147 95   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 13:37:02 Download gff for BO11474.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 9783853..9783959 9..116 97 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-30 02:11:31 Download gff for BO11474.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 5609575..5609681 9..116 97 <- Plus

BO11474.5prime Sequence

152 bp (151 high quality bases) assembled on 2006-04-19

> BO11474.5prime
GAAGTTATCAGTCGACATGCCTTGCCCATGCGGAAGCGGATGCAAATGCG
CCAGCCAGGCCACCAAGGGATCCTGCAACTGCGGATCTGACTGCAAGTGC
GGCGGCGACAAGAAATCCGCCTGCGGCTGCTCCGAGGCAAGCTTTCTAGA
CC

BO11474.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 14:23:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG9470-PA 123 MtnA-RA 1..120 17..136 600 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 13:16:50
Subject Length Description Subject Range Query Range Score Percent Strand
MtnA-RB 700 CG9470-RB 126..245 17..136 600 100 Plus
MtnA-RA 329 CG9470-RA 126..245 17..136 600 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 13:16:45
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 9783862..9783960 136..38 495 100 Minus
Blast to na_te.dros performed on 2015-02-12 13:16:47 has no hits.

BO11474.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 05:07:39 Download gff for BO11474.5prime
Subject Subject Range Query Range Percent Splice Strand
MtnA-PA 1..123 17..139 98   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 04:31:50 Download gff for BO11474.5prime
Subject Subject Range Query Range Percent Splice Strand
CG9470-PA 1..123 17..139 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-30 06:25:37 Download gff for BO11474.5prime
Subject Subject Range Query Range Percent Splice Strand
MtnA-RA 117..254 8..146 95   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 16:43:23 Download gff for BO11474.5prime
Subject Subject Range Query Range Percent Splice Strand
MtnA-RA 117..254 8..146 95   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 16:43:23 Download gff for BO11474.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 9783853..9783959 39..146 97 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-30 06:25:37 Download gff for BO11474.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 5609575..5609681 39..146 97 <- Minus

BO11474.complete Sequence

154 bp assembled on 2007-12-19

GenBank Submission: FJ632095

> BO11474.complete
GAAGTTATCAGTCGACATGCCTTGCCCATGCGGAAGCGGATGCAAATGCG
CCAGCCAGGCCACCAAGGGATCCTGCAACTGCGGATCTGACTGCAAGTGC
GGCGGCGACAAGAAATCCGCCTGCGGCTGCTCCGAGGCAAGCTTTCTAGA
CCAT

BO11474.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 20:08:49
Subject Length Description Subject Range Query Range Score Percent Strand
MtnA-RB 123 CG9470-PB 1..120 17..136 600 100 Plus
MtnA-RA 123 CG9470-PA 1..120 17..136 600 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 20:08:50
Subject Length Description Subject Range Query Range Score Percent Strand
MtnA-RB 700 CG9470-RB 126..245 17..136 600 100 Plus
MtnA-RA 329 CG9470-RA 126..245 17..136 600 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 20:08:47
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 9783862..9783960 136..38 495 100 Minus
Blast to na_te.dros performed on 2014-11-27 20:08:48 has no hits.

BO11474.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:58:36 Download gff for BO11474.complete
Subject Subject Range Query Range Percent Splice Strand
MtnA-RA 1..123 17..139 98   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-07-28 15:36:04 Download gff for BO11474.complete
Subject Subject Range Query Range Percent Splice Strand
MtnA-RA 127..246 17..138 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:07:16 Download gff for BO11474.complete
Subject Subject Range Query Range Percent Splice Strand
MtnA-RA 126..245 17..138 98   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:58:36 Download gff for BO11474.complete
Subject Subject Range Query Range Percent Splice Strand
MtnA-RA 118..255 8..146 95   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 21:15:50 Download gff for BO11474.complete
Subject Subject Range Query Range Percent Splice Strand
MtnA-RA 126..245 17..138 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 21:15:50 Download gff for BO11474.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9783859..9783959 39..138 98 <- Minus
3R 9784224..9784245 17..38 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:07:16 Download gff for BO11474.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 5609581..5609681 39..138 98 <- Minus
arm_3R 5609946..5609967 17..38 100   Minus

BO11474.pep Sequence

Translation from 16 to 154

> BO11474.pep
MPCPCGSGCKCASQATKGSCNCGSDCKCGGDKKSACGCSEASFLDH

BO11474.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:42:15
Subject Length Description Subject Range Query Range Score Percent Strand
MtnA-PB 40 CG9470-PB 1..40 1..40 245 100 Plus
MtnA-PA 40 CG9470-PA 1..40 1..40 245 100 Plus