Clone BO11475 Report

Search the DGRC for BO11475

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:114
Well:75
Vector:pDNR-Dual
Associated Gene/TranscriptCG17567-RA
Protein status:BO11475.pep: validated full length
Sequenced Size:229

Clone Sequence Records

BO11475.3prime Sequence

227 bp (226 high quality bases) assembled on 2006-04-19

> BO11475.3prime
ATGGTCTAGAAAGCTTGCACATTTATAAAATTCGTTTATTGGGACATGTT
GGGTATCTACGAGTGTTTCAGGTACAATATGGTTGAACGTGTTTCGGCAC
CTGGCACATCCCCACTTCAGCAACAGCCTCTTGGTCCGCAGGGCATAAAT
GAGCACTGGATGTAGGCTGGGGTGCAGGGTACACAGCAGAGTTCCACGCA
GCAGTTGTAGCATGTCGACTGATAACT

BO11475.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 14:23:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG17567-PA 198 CG17567-RA 1..195 213..19 975 100 Minus
CG17567-PB 198 CG17567-RB 1..195 213..19 975 100 Minus
CG17567-PC 198 CG17567-RC 1..195 213..19 975 100 Minus
CG17567-PD 198 CG17567-RD 1..195 213..19 975 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 22:42:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG46059-RC 596 CG46059-RC 401..595 213..19 975 100 Minus
CG46059-RB 409 CG46059-RB 214..408 213..19 975 100 Minus
CG46059-RA 405 CG46059-RA 210..404 213..19 975 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 22:42:20
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 19183094..19183288 19..213 975 100 Plus
Blast to na_te.dros performed on 2015-02-10 22:42:23 has no hits.

BO11475.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 05:07:41 Download gff for BO11475.3prime
Subject Subject Range Query Range Percent Splice Strand
CG17567-PB 1..198 15..213 98   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 04:31:52 Download gff for BO11475.3prime
Subject Subject Range Query Range Percent Splice Strand
CG17567-PD 1..198 15..213 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 00:02:56 Download gff for BO11475.3prime
Subject Subject Range Query Range Percent Splice Strand
CG46059-RA 207..405 18..217 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 00:02:56 Download gff for BO11475.3prime
Subject Subject Range Query Range Percent Splice Strand
2L 19183085..19183291 11..217 97   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-21 09:49:33 Download gff for BO11475.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 19183085..19183291 11..217 97   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-21 09:49:33 Download gff for BO11475.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 19183085..19183291 11..217 97   Plus

BO11475.5prime Sequence

227 bp (226 high quality bases) assembled on 2006-04-19

> BO11475.5prime
GAAGTTATCAGTCGACATGCTACAACTGCTGCGTGGAACTCTGCTGTGTA
CCCTGCACCCCAGCCTACATCCAGTGCTCATTTATGCCCTGCGGACCAAG
AGGCTGTTGCTGAAGTGGGGATGTGCCAGGTGCCGAAACACGTTCAACCA
TATTGTACCTGAAACACTCGTAGATACCCAACATGTCCCAATAAACGAAT
TTTATAAATGTGCAAGCTTTCTAGACC

BO11475.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 14:23:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG17567-PA 198 CG17567-RA 1..195 17..211 975 100 Plus
CG17567-PB 198 CG17567-RB 1..195 17..211 975 100 Plus
CG17567-PC 198 CG17567-RC 1..195 17..211 975 100 Plus
CG17567-PD 198 CG17567-RD 1..195 17..211 975 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 20:48:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG46059-RC 596 CG46059-RC 401..595 17..211 975 100 Plus
CG46059-RB 409 CG46059-RB 214..408 17..211 975 100 Plus
CG46059-RA 405 CG46059-RA 210..404 17..211 975 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 20:48:45
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 19183094..19183288 211..17 975 100 Minus
Blast to na_te.dros performed on 2015-02-10 20:48:47 has no hits.

BO11475.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 05:07:42 Download gff for BO11475.5prime
Subject Subject Range Query Range Percent Splice Strand
CG17567-PB 1..198 17..215 98   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 04:31:53 Download gff for BO11475.5prime
Subject Subject Range Query Range Percent Splice Strand
CG17567-PD 1..198 17..215 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 23:24:18 Download gff for BO11475.5prime
Subject Subject Range Query Range Percent Splice Strand
CG46059-RA 207..405 13..212 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 23:24:18 Download gff for BO11475.5prime
Subject Subject Range Query Range Percent Splice Strand
2L 19183085..19183291 13..219 97   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-21 04:01:14 Download gff for BO11475.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 19183085..19183291 13..219 97   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-21 04:01:14 Download gff for BO11475.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 19183085..19183291 13..219 97   Minus

BO11475.complete Sequence

229 bp assembled on 2006-10-10

GenBank Submission: FJ632096

> BO11475.complete
GAAGTTATCAGTCGACATGCTACAACTGCTGCGTGGAACTCTGCTGTGTA
CCCTGCACCCCAGCCTACATCCAGTGCTCATTTATGCCCTGCGGACCAAG
AGGCTGTTGCTGAAGTGGGGATGTGCCAGGTGCCGAAACACGTTCAACCA
TATTGTACCTGAAACACTCGTAGATACCCAACATGTCCCAATAAACGAAT
TTTATAAATGTGCAAGCTTTCTAGACCAT

BO11475.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 20:53:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG46059-RC 144 CG46059-PC 48..144 17..113 485 100 Plus
CG46059-RB 144 CG46059-PB 48..144 17..113 485 100 Plus
CG46059-RA 144 CG46059-PA 48..144 17..113 485 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 20:53:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG46059-RC 596 CG46059-RC 401..595 17..211 975 100 Plus
CG46059-RB 409 CG46059-RB 214..408 17..211 975 100 Plus
CG46059-RA 405 CG46059-RA 210..404 17..211 975 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 20:53:06
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 19183094..19183288 211..17 975 100 Minus
Blast to na_te.dros performed on 2014-11-27 20:53:07 has no hits.

BO11475.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:27:30 Download gff for BO11475.complete
Subject Subject Range Query Range Percent Splice Strand
CG17567-RC 1..198 17..215 98   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 05:47:06 Download gff for BO11475.complete
Subject Subject Range Query Range Percent Splice Strand
CG17567-RA 220..420 13..215 98   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:27:30 Download gff for BO11475.complete
Subject Subject Range Query Range Percent Splice Strand
CG17567-RA 220..420 13..215 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 21:30:18 Download gff for BO11475.complete
Subject Subject Range Query Range Percent Splice Strand
CG46059-RA 210..405 17..212 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 21:30:18 Download gff for BO11475.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19183092..19183288 17..213 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:15:13 Download gff for BO11475.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 19183092..19183288 17..213 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:15:13 Download gff for BO11475.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 19183092..19183288 17..213 98   Minus

BO11475.pep Sequence

Translation from 16 to 229

> BO11475.pep
MLQLLRGTLLCTLHPSLHPVLIYALRTKRLLLKWGCARCRNTFNHIVPET
LVDTQHVPINEFYKCASFLDH
Sequence BO11475.pep has no blast hits.